Comparing WP_057509261.1 NCBI__GCF_001431535.1:WP_057509261.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
51% identity, 94% coverage: 28:541/545 of query aligns to 17:525/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
51% identity, 94% coverage: 28:541/545 of query aligns to 17:525/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
51% identity, 94% coverage: 28:541/545 of query aligns to 12:520/524 of 3cv2A
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
47% identity, 96% coverage: 19:541/545 of query aligns to 2:498/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 94% coverage: 31:544/545 of query aligns to 31:541/554 of P30952
Sites not aligning to the query:
1n8iA Biochemical and structural studies of malate synthase from mycobacterium tuberculosis (see paper)
27% identity, 68% coverage: 103:475/545 of query aligns to 243:626/701 of 1n8iA
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 245:673/706 of 5cahA
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 249:679/712 of 6dnpA
5cc3A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6-bromo-1h-indole-2-carboxylic acid
27% identity, 77% coverage: 103:524/545 of query aligns to 249:682/715 of 5cc3A
Sites not aligning to the query:
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 249:683/716 of 6c8pA
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 249:678/711 of 5cjmA
Sites not aligning to the query:
3sadA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-mehtylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 246:676/709 of 3sadA
6ba7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-cl-4-oh-phenyldiketoacid (see paper)
27% identity, 68% coverage: 103:475/545 of query aligns to 247:633/709 of 6ba7A
Sites not aligning to the query:
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 247:678/711 of 6c2xA
Sites not aligning to the query:
6dljA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-nitro-phenyldiketoacid (see paper)
27% identity, 68% coverage: 103:475/545 of query aligns to 244:628/704 of 6dljA
Sites not aligning to the query:
5driA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-5-yl)-4-oxobut-2-enoic acid inhibitor (see paper)
26% identity, 68% coverage: 103:475/545 of query aligns to 246:633/708 of 5driA
5cc7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-6-carboxylic acid
26% identity, 68% coverage: 103:475/545 of query aligns to 246:629/704 of 5cc7A
Sites not aligning to the query:
5cc6A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-5-carboxylic acid
26% identity, 68% coverage: 103:475/545 of query aligns to 243:626/701 of 5cc6A
Sites not aligning to the query:
6as6A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-prop-6-me-phenyldiketoacid (see paper)
26% identity, 77% coverage: 103:524/545 of query aligns to 249:679/712 of 6as6A
3sb0A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-chloro-6-fluoro-3-methylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
27% identity, 77% coverage: 103:524/545 of query aligns to 245:675/708 of 3sb0A
Sites not aligning to the query:
>WP_057509261.1 NCBI__GCF_001431535.1:WP_057509261.1
MSAVASAIPSPSAKPTPGITLTTQVAGQSALLPAPLLALLVSLHRAVEPGRQARLAARVQ
RQAFFDQGGLPDFRTDTAPIRAEDWKVAPLPAALLDRRVEITGPTDPKMVINALNSGAKV
FMADFEDATAPTWGNLLAGQQSLIGAVRGDLQFTAPASGSKPSKHYSLRPYEERAVLIVR
PRGWHLDEKHVLVDGQRLAGGLFDAAVFAYHNARTLMANDRGPYFYLPKLQSMEEAALWE
TALSHIEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKT
FRRHADKVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPIGNDAAANEQA
MARVRADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQQQVLRQDVRVDRDQLIA
RPPGSISRAGFEGNVEVCVRYLAAWLDGNGCVPIHNLMEDAATAEISRSQLWQWLHTPGQ
QLDDGTAIDAALLDNALAQLPARLGDRATLPGGGRVDEAIALLAELSRADELNDFLTLPA
YARID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory