SitesBLAST
Comparing WP_057509293.1 NCBI__GCF_001431535.1:WP_057509293.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
55% identity, 99% coverage: 1:329/334 of query aligns to 1:326/330 of 4cukA
- active site: S101 (= S105), R234 (= R237), D258 (= D261), E263 (= E266), H295 (= H298)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y104), G153 (= G157), K154 (= K158), I155 (= I159), F173 (≠ H177), D174 (= D178), P175 (= P179), H204 (= H207), C205 (= C208), P206 (= P209), N211 (≠ T214), T232 (= T235), Y260 (= Y263), H295 (= H298), A297 (≠ G300)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
56% identity, 97% coverage: 1:325/334 of query aligns to 8:329/336 of 5z20F
- active site: S108 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H302 (= H298)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y104), G160 (= G157), Q161 (≠ K158), I162 (= I159), Y180 (≠ H177), D181 (= D178), P182 (= P179), C212 (= C208), P213 (= P209), T218 (= T214), T239 (= T235), G240 (≠ S236), R241 (= R237), H302 (= H298), A304 (≠ G300)
8grvA Dictyostelium discoideum lactate dehydrogenase (dicldha)with NAD
42% identity, 97% coverage: 1:324/334 of query aligns to 3:324/336 of 8grvA
- binding nicotinamide-adenine-dinucleotide: V106 (= V109), G154 (= G157), N155 (≠ K158), I156 (= I159), D176 (= D178), I177 (≠ P179), I178 (≠ Y180), T208 (≠ C208), P209 (= P209), T214 (= T214), V235 (≠ T235), H298 (= H298), A300 (≠ G300), W301 (≠ F301)
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
45% identity, 99% coverage: 2:331/334 of query aligns to 3:329/331 of 5z21B
- active site: S101 (= S105), R235 (= R237), D259 (= D261), E264 (= E266), H296 (= H298)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y104), I105 (≠ V109), G153 (= G157), K154 (= K158), I155 (= I159), D174 (= D178), L175 (≠ P179), P207 (= P209), T212 (= T214), T233 (= T235), G234 (≠ S236), R235 (= R237), H296 (= H298), Y299 (≠ F301)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
48% identity, 90% coverage: 33:333/334 of query aligns to 39:346/346 of 4zgsA
- active site: S111 (= S105), R244 (= R237), D268 (= D261), E273 (= E266), H311 (= H298)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y104), G163 (= G157), A164 (≠ K158), I165 (= I159), D184 (= D178), C215 (= C208), P216 (= P209), L218 (≠ T211), S220 (≠ Q213), T221 (= T214), S243 (= S236), H311 (= H298), F314 (= F301)
P26297 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) (see 2 papers)
37% identity, 94% coverage: 20:334/334 of query aligns to 18:333/333 of P26297
- HI 156:157 (≠ KI 158:159) binding
- D176 (= D178) binding
- H206 (= H207) mutation to Q: Increase of activity.
- VP 207:208 (≠ CP 208:209) binding
- N213 (≠ T214) binding
- R236 (= R237) mutation to K: Decrease of activity.
- D260 (= D261) binding ; mutation to N: Decrease of activity.
- E265 (= E266) mutation to Q: Decrease of activity.
- H297 (= H298) mutation to Q: 90% loss of activity.
2dldA D-lactate dehydrogenase complexed with nadh and oxamate
38% identity, 89% coverage: 20:317/334 of query aligns to 18:316/337 of 2dldA
- active site: S103 (= S105), R236 (= R237), D260 (= D261), E265 (= E266), H297 (= H298)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T154 (= T156), G155 (= G157), H156 (≠ K158), I157 (= I159), D176 (= D178), I177 (≠ P179), V207 (≠ C208), P208 (= P209), N213 (≠ T214), C234 (≠ T235), S235 (= S236), H297 (= H298)
Sites not aligning to the query:
P30901 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus helveticus (Lactobacillus suntoryeus) (see paper)
38% identity, 89% coverage: 20:317/334 of query aligns to 18:316/337 of P30901
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1j49A Insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus (see paper)
38% identity, 93% coverage: 20:331/334 of query aligns to 18:330/332 of 1j49A
- active site: S103 (= S105), R236 (= R237), D260 (= D261), E265 (= E266), H297 (= H298)
- binding nicotinamide-adenine-dinucleotide: Y102 (= Y104), I107 (≠ V109), G153 (= G155), G155 (= G157), I157 (= I159), Y175 (≠ H177), D176 (= D178), I177 (≠ P179), V207 (≠ C208), P208 (= P209), N213 (≠ T214), V234 (≠ T235), S235 (= S236), R236 (= R237), H297 (= H298), A299 (≠ G300), F300 (= F301)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
32% identity, 99% coverage: 1:332/334 of query aligns to 1:329/333 of P17584
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
32% identity, 99% coverage: 1:332/334 of query aligns to 1:329/330 of 1dxyA
- active site: S101 (= S105), R234 (= R237), D258 (= D261), E263 (= E266), H295 (= H298)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ A81), Y100 (= Y104), Y298 (≠ F301)
- binding nicotinamide-adenine-dinucleotide: Y100 (= Y104), G152 (= G155), G154 (= G157), H155 (≠ K158), I156 (= I159), Y174 (≠ H177), D175 (= D178), P176 (= P179), H204 (= H207), V205 (≠ C208), P206 (= P209), N211 (≠ T214), T232 (= T235), A233 (≠ S236), R234 (= R237), H295 (= H298), Y298 (≠ F301)
4xkjA A novel d-lactate dehydrogenase from sporolactobacillus sp
36% identity, 97% coverage: 1:325/334 of query aligns to 1:323/332 of 4xkjA
- active site: S102 (= S105), R234 (= R237), D258 (= D261), E263 (= E266), H295 (= H298)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y104), V106 (= V109), G152 (= G155), G154 (= G157), R155 (≠ K158), I156 (= I159), D175 (= D178), I176 (≠ P179), R179 (≠ S182), H204 (= H207), V205 (≠ C208), P206 (= P209), T211 (= T214), A232 (≠ T235), R234 (= R237), H295 (= H298), G297 (= G300), F298 (= F301)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
35% identity, 87% coverage: 35:324/334 of query aligns to 22:320/334 of 3kb6B
- active site: S97 (= S105), R231 (= R237), D255 (= D261), E260 (= E266), H294 (= H298)
- binding lactic acid: F49 (= F55), S72 (≠ C80), V73 (≠ A81), G74 (= G82), Y96 (= Y104), R231 (= R237), H294 (= H298)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A81), Y96 (= Y104), V101 (= V109), G150 (= G157), R151 (≠ K158), I152 (= I159), D171 (= D178), V172 (≠ P179), P203 (= P209), T229 (= T235), A230 (≠ S236), R231 (= R237), H294 (= H298), A296 (≠ G300), Y297 (≠ F301)
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
32% identity, 97% coverage: 1:324/334 of query aligns to 1:321/330 of 4prlA
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y104), I106 (≠ V109), V154 (≠ T156), G155 (= G157), H156 (≠ K158), I157 (= I159), Y175 (≠ H177), D176 (= D178), H205 (= H207), T206 (≠ C208), P207 (= P209), A233 (≠ T235), A234 (≠ S236), D259 (= D261), H295 (= H298), A297 (≠ G300)
2yq5C Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. Bulgaricus: NAD complexed form (see paper)
30% identity, 97% coverage: 2:324/334 of query aligns to 2:323/331 of 2yq5C
- active site: S102 (= S105), R236 (= R237), D260 (= D261), E265 (= E266), H297 (= H298)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y104), I106 (≠ V109), V155 (≠ T156), G156 (= G157), H157 (≠ K158), I158 (= I159), Y176 (≠ H177), D177 (= D178), V178 (≠ P179), H206 (= H207), T207 (≠ C208), P208 (= P209), A235 (≠ S236), R236 (= R237), H297 (= H298), F300 (= F301)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 87% coverage: 28:318/334 of query aligns to 21:302/304 of 1wwkA
- active site: S96 (= S105), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H298)
- binding nicotinamide-adenine-dinucleotide: V100 (= V109), G146 (= G155), F147 (≠ T156), G148 (= G157), R149 (≠ K158), I150 (= I159), Y168 (≠ H177), D169 (= D178), P170 (= P179), V201 (≠ C208), P202 (= P209), T207 (= T214), T228 (= T235), S229 (= S236), D254 (= D261), H278 (= H298), G280 (= G300)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
33% identity, 86% coverage: 47:333/334 of query aligns to 44:323/334 of 5aovA
- active site: L100 (≠ S105), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H298)
- binding glyoxylic acid: M52 (≠ F55), L53 (≠ V56), L53 (≠ V56), Y74 (≠ R79), A75 (≠ C80), V76 (≠ A81), G77 (= G82), R241 (= R237), H288 (= H298)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A81), T104 (≠ V109), F158 (≠ T156), G159 (= G157), R160 (≠ K158), I161 (= I159), S180 (≠ D178), R181 (vs. gap), A211 (≠ H207), V212 (≠ C208), P213 (= P209), T218 (= T214), I239 (≠ T235), A240 (≠ S236), R241 (= R237), H288 (= H298), G290 (= G300)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
35% identity, 85% coverage: 29:312/334 of query aligns to 26:304/331 of 1hl3A
- active site: S99 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H298)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V109), G158 (= G157), R159 (≠ K158), V160 (≠ I159), D179 (= D178), Y181 (= Y180), H211 (= H207), C212 (= C208), G213 (≠ P209), N218 (≠ T214), T239 (= T235), A240 (≠ S236), R241 (= R237), D265 (= D261), H290 (= H298)
- binding : V26 (= V29), A27 (≠ E30), F28 (= F31), C29 (≠ L32), E36 (≠ D39), H38 (= H41), E39 (≠ T42)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
35% identity, 85% coverage: 29:312/334 of query aligns to 26:304/331 of 1hkuA
- active site: S99 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H298)
- binding nicotinamide-adenine-dinucleotide: S75 (≠ A81), T103 (≠ V109), G156 (= G155), G158 (= G157), R159 (≠ K158), V160 (≠ I159), Y178 (≠ H177), D179 (= D178), P180 (= P179), Y181 (= Y180), C212 (= C208), N218 (≠ T214), T239 (= T235), A240 (≠ S236), R241 (= R237), H290 (= H298), W293 (≠ F301)
Sites not aligning to the query:
Q9Z2F5 C-terminal-binding protein 1; CtBP1; 50 kDa BFA-dependent ADP-ribosylation substrate; BARS-50; C-terminal-binding protein 3; CtBP3; EC 1.1.1.- from Rattus norvegicus (Rat) (see 3 papers)
35% identity, 85% coverage: 29:312/334 of query aligns to 40:318/430 of Q9Z2F5
- A41 (≠ E30) mutation to E: Strongly reduces interaction with E1A.
- V55 (≠ A44) mutation to R: Strongly reduces interaction with E1A.
- S89 (≠ A81) binding
- IGLGRV 169:174 (≠ VGTGKI 154:159) binding
- G172 (= G157) mutation to E: Loss dimerization and of NAD binding.
- D193 (= D178) binding
- 226:232 (vs. 208:214, 29% identical) binding
- TAR 253:255 (≠ TSR 235:237) binding
- D279 (= D261) binding
Query Sequence
>WP_057509293.1 NCBI__GCF_001431535.1:WP_057509293.1
MKVAVFSARPYDSRSLDEANQQAGAAHGVEFLYYDATLDVHTAALAQGCDAVCVFVNDRL
DAPVLQALHGMGVRAVLLRCAGFNNVDLAAAERLGFFVARVPAYSPEAVAEHTLALIMTL
NRQTHRAFNRVREGNFMLEGLLGRTLHGKTAGIVGTGKIGLATARILHGMGCTVLGHDPY
PSPDFAGLGEFVSLQDLLARSDIVSLHCPLTIQTRHLINDDSLALMKPGAMLVNTSRGGL
VDTDAVIRALKSRQLGHLAIDVYEQESALFFQDRSGQIIDDDVFQRLMTFPNVLVTGHQG
FFTTEALQEIAETTLGNLGHFAAGTECPNEVTSG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory