SitesBLAST
Comparing WP_057509297.1 NCBI__GCF_001431535.1:WP_057509297.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
58% identity, 99% coverage: 1:322/324 of query aligns to 10:330/344 of C8WR67
- YGSQ 25:28 (= YGSQ 16:19) binding
- R48 (= R39) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (≠ T44) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DMVQ 74:77) binding
- G133 (= G125) binding
- D190 (= D182) binding
- E194 (= E186) binding
- E226 (= E218) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
58% identity, 99% coverage: 1:322/324 of query aligns to 9:329/333 of 4tskA
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding magnesium ion: D189 (= D182), D189 (= D182), E193 (= E186), E193 (= E186), R246 (≠ L239), Y247 (≠ E240), I249 (= I242), D251 (≠ E244), Q254 (= Q247)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), L46 (= L38), R47 (= R39), S51 (≠ T44), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124)
C1DFH7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Azotobacter vinelandii (strain DJ / ATCC BAA-1303) (see paper)
54% identity, 97% coverage: 6:319/324 of query aligns to 14:327/338 of C1DFH7
- D190 (= D182) binding
- E226 (= E218) binding
- E230 (= E222) binding
4xiyA Crystal structure of ketol-acid reductoisomerase from azotobacter (see paper)
54% identity, 97% coverage: 6:319/324 of query aligns to 14:327/328 of 4xiyA
8upqB Campylobacter jejuni ketol-acid reductoisomerase in complex with 2,3- dihydroxy-3-isovalerate.
52% identity, 98% coverage: 4:322/324 of query aligns to 13:331/342 of 8upqB
4ypoA Crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+ (see paper)
56% identity, 96% coverage: 10:319/324 of query aligns to 16:325/325 of 4ypoA
P9WKJ7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
56% identity, 96% coverage: 10:319/324 of query aligns to 20:329/337 of P9WKJ7
- D192 (= D182) binding ; binding
- E196 (= E186) binding
- E228 (= E218) binding
- E232 (= E222) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7rduA Crystal structure of campylobacter jejuni keto said reductoisomerase in complex with magnesium and oxidixized and reduced NADPH
52% identity, 98% coverage: 4:320/324 of query aligns to 13:329/329 of 7rduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G15), G26 (= G17), S27 (= S18), Q28 (= Q19), R48 (= R39), S51 (≠ G42), S53 (≠ T44), A81 (≠ T72), P82 (= P73), D83 (= D74), I89 (≠ L80), A107 (= A98), H108 (= H99), P130 (= P121), K131 (= K122), A132 (≠ G123)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G24 (= G15), F25 (≠ Y16), G26 (= G17), S27 (= S18), Q28 (= Q19), S51 (≠ G42), S53 (≠ T44), L80 (= L71), P82 (= P73), D83 (= D74), I89 (≠ L80), A107 (= A98), H108 (= H99)
8uppA Campylobacter jejuni ketol-acid reductoisomerase in complex with NADPH and hoe704
52% identity, 98% coverage: 4:319/324 of query aligns to 12:327/327 of 8uppA
- binding magnesium ion: D190 (= D182), E194 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F24 (≠ Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), R47 (= R39), S50 (≠ G42), L79 (= L71), P81 (= P73), D82 (= D74), I84 (≠ V76), Q85 (= Q77), I88 (≠ L80), H107 (= H99), P132 (= P124), I250 (= I242), S251 (= S243)
- binding (2R)-(dimethylphosphoryl)(hydroxy)acetic acid: A131 (≠ G123), P132 (= P124), D190 (= D182), E194 (= E186), E230 (= E222), I250 (= I242), S251 (= S243), A254 (= A246)
8sxdA Campylobacter jejuni keto-acid reductoisomerase in complex with intermediate and NADP+
52% identity, 98% coverage: 4:319/324 of query aligns to 12:327/327 of 8sxdA
- binding magnesium ion: D190 (= D182), E194 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G15), F24 (≠ Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), S50 (≠ G42), S52 (≠ T44), L79 (= L71), A80 (≠ T72), P81 (= P73), D82 (= D74), P129 (= P121)
- binding 3-hydroxy-3-methyl-2-oxobutanoic acid: D190 (= D182), E194 (= E186)
8swmA Crystal structure of campylobacter jejuni ketol-acid reductoisomerase in complex with 2-acetolactate
52% identity, 97% coverage: 4:318/324 of query aligns to 9:323/323 of 8swmA
8ep7C Crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with NADP
57% identity, 96% coverage: 11:320/324 of query aligns to 19:327/328 of 8ep7C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), Q83 (≠ V76), V87 (≠ L80), H106 (= H99)
6jx2B Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
56% identity, 96% coverage: 10:319/324 of query aligns to 18:327/327 of 6jx2B
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
56% identity, 99% coverage: 1:320/324 of query aligns to 9:327/327 of 6bulB
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), E229 (= E222), I233 (= I226), I249 (= I242), S250 (= S243), A253 (= A246)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), E229 (= E222), I233 (= I226), I249 (= I242), S250 (= S243), A253 (= A246)
- binding magnesium ion: D189 (= D182), E193 (= E186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124), S248 (≠ F241), I249 (= I242), S250 (= S243)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
56% identity, 98% coverage: 1:319/324 of query aligns to 9:326/326 of 6vo2A
- binding magnesium ion: D189 (= D182), E193 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124), I249 (= I242), S250 (= S243)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G123), P131 (= P124), D189 (= D182), E193 (= E186), E229 (= E222), I249 (= I242), S250 (= S243), A253 (= A246)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
56% identity, 98% coverage: 1:319/324 of query aligns to 9:326/326 of 6c5nA
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), C198 (= C191), E229 (= E222), I233 (= I226), I249 (= I242), S250 (= S243), A253 (= A246)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), C198 (= C191), E229 (= E222), I249 (= I242), S250 (= S243), A253 (= A246)
- binding magnesium ion: D189 (= D182), E193 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124), S248 (≠ F241), I249 (= I242), S250 (= S243)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
56% identity, 98% coverage: 1:319/324 of query aligns to 9:326/326 of 6c55A
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), C198 (= C191)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), C198 (= C191), I249 (= I242), S250 (= S243), A253 (= A246)
- binding magnesium ion: D189 (= D182), E193 (= E186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L79 (≠ T72), P80 (= P73), D81 (= D74), I83 (≠ V76), H106 (= H99), S248 (≠ F241), S250 (= S243)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
56% identity, 98% coverage: 1:319/324 of query aligns to 9:326/326 of 6aqjA
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding oxo(propan-2-ylamino)acetic acid: P131 (= P124), D189 (= D182), E193 (= E186), E229 (= E222), I233 (= I226), I249 (= I242), S250 (= S243), A253 (= A246)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (= P124), D189 (= D182), E193 (= E186), E229 (= E222), I249 (= I242), S250 (= S243), A253 (= A246)
- binding magnesium ion: D189 (= D182), E193 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124), I249 (= I242), S250 (= S243)
5w3kA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex NADPH, mg2+ and cpd (see paper)
56% identity, 98% coverage: 1:319/324 of query aligns to 9:326/326 of 5w3kA
- active site: K129 (= K122), D189 (= D182), E193 (= E186)
- binding cyclopropane-1,1-dicarboxylic acid: D189 (= D182), E193 (= E186), E229 (= E222), I249 (= I242), S250 (= S243), A253 (= A246)
- binding magnesium ion: V69 (= V62), K70 (= K63), A72 (= A65), N100 (≠ A93), D189 (= D182), E193 (= E186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y16), G25 (= G17), S26 (= S18), Q27 (= Q19), I46 (≠ L38), R47 (= R39), S51 (≠ P43), L78 (= L71), L79 (≠ T72), P80 (= P73), D81 (= D74), H106 (= H99), P131 (= P124), G132 (= G125), I249 (= I242), S250 (= S243)
6jx2A Crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum (see paper)
57% identity, 95% coverage: 10:316/324 of query aligns to 18:324/325 of 6jx2A
- binding magnesium ion: N98 (≠ K90), D101 (≠ A93), D190 (= D182), E194 (= E186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G15), Y24 (= Y16), G25 (= G17), R47 (= R39), S50 (≠ G42), K51 (≠ P43), S52 (≠ T44), A80 (≠ T72), P81 (= P73), I88 (≠ L80)
Query Sequence
>WP_057509297.1 NCBI__GCF_001431535.1:WP_057509297.1
MSTNDLPQTKIAVVGYGSQGRAHALNLRESGFDVVVGLRPGGPTEVKAQADGFTVKAPAE
AVKDADLVAVLTPDMVQKKLYDEVLAPNMKQGAVLLFAHGLNVHFDMITPREDLDVVLVA
PKGPGALVRREYEIGRGVPCIWAVHQDKSGNAAKHALAYATGLGGARANLIQTTFKEETE
TDLFGEQAVLCGGASALVQAGFETLVEAGYQPEIAYYEVLHELKLIVDLFYEGGISRMLE
FISETAQYGDYVSGPRVIDAGTKERMKEVLKDIQDGTFTKNWVAEYEAGLPNYNKFKQAD
LDHPIEKVGKELRAKMVWLQGQAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory