SitesBLAST
Comparing WP_057509298.1 NCBI__GCF_001431535.1:WP_057509298.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
47% identity, 95% coverage: 12:561/578 of query aligns to 7:539/539 of 6lpiB
- active site: I27 (≠ Y32), G29 (= G34), G30 (= G35), S31 (≠ T36), I32 (= I37), E53 (= E57), C76 (≠ T80), F115 (= F119), Q116 (= Q120), E117 (= E121), K165 (= K169), M256 (= M262), A283 (= A289), V375 (= V392), G401 (= G418), M403 (= M420), D428 (= D445), N455 (= N472), A457 (≠ S474), L458 (= L475), L460 (≠ M477), V461 (= V478), Q464 (≠ W481)
- binding flavin-adenine dinucleotide: R155 (= R159), G212 (= G216), G213 (= G217), G214 (= G218), T236 (= T242), L237 (= L243), M238 (≠ R244), L254 (= L260), M256 (= M262), H257 (= H263), G276 (= G282), A277 (= A283), R278 (= R284), D280 (= D286), R282 (= R288), A283 (= A289), D300 (= D306), I301 (≠ A307), D319 (≠ N325), V320 (= V326), M380 (= M397), G398 (= G415)
- binding magnesium ion: D428 (= D445), N455 (= N472)
- binding thiamine diphosphate: E53 (= E57), C76 (≠ T80), P79 (= P83), G376 (= G393), Q377 (= Q394), H378 (= H395), G401 (= G418), M403 (= M420), G427 (= G444), D428 (= D445), G429 (= G446), S430 (= S447), M433 (= M450), N455 (= N472), A457 (≠ S474), L458 (= L475), G459 (= G476), L460 (≠ M477), V461 (= V478)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
46% identity, 94% coverage: 10:552/578 of query aligns to 90:646/664 of P09114
- P191 (≠ A110) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W481) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
46% identity, 94% coverage: 10:552/578 of query aligns to 93:649/667 of P09342
- C161 (= C77) modified: Disulfide link with 307
- P194 (≠ A110) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ I219) modified: Disulfide link with 161
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M262), R292 (= R288), W489 (= W481), S568 (≠ P553)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (= S447), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), M263 (= M259), L264 (= L260), M266 (= M262), H267 (= H263), G286 (= G282), R288 (= R284), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415)
- binding magnesium ion: A37 (≠ T36), T82 (= T80), S83 (= S81), Q122 (= Q120), Y381 (≠ A373), D453 (= D445), M458 (= M450), Q461 (= Q453), N480 (= N472), H482 (≠ S474), K533 (≠ R518)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/583 of 5k3sA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R288), M485 (= M477), W489 (= W481), G569 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), M266 (= M262), G286 (= G282), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
45% identity, 96% coverage: 10:564/578 of query aligns to 96:665/670 of P17597
- A122 (≠ T36) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (= M38) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E57) binding
- S186 (= S99) binding
- P197 (≠ A110) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P112) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q120) binding
- K220 (= K133) binding
- R246 (= R159) binding ; binding
- K256 (= K169) binding
- G308 (= G217) binding
- TL 331:332 (= TL 242:243) binding
- C340 (≠ A251) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 260:263) binding
- GVRFD 371:375 (≠ GARFD 282:286) binding
- DR 376:377 (= DR 287:288) binding
- DI 395:396 (≠ DA 306:307) binding
- DV 414:415 (≠ NV 325:326) binding
- QH 487:488 (= QH 394:395) binding
- GG 508:509 (≠ GA 415:416) binding
- GAM 511:513 (≠ GTM 418:420) binding
- D538 (= D445) binding
- DGS 538:540 (= DGS 445:447) binding
- N565 (= N472) binding
- NQHLGM 565:570 (≠ NSSLGM 472:477) binding
- H567 (≠ S474) binding
- W574 (= W481) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P553) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 10:579/582 of 3ea4A
- active site: Y32 (= Y32), G34 (= G34), G35 (= G35), A36 (≠ T36), S37 (≠ I37), E58 (= E57), T81 (= T80), F120 (= F119), Q121 (= Q120), E122 (= E121), K170 (= K169), M265 (= M262), V292 (≠ A289), V399 (= V392), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ S474), L482 (= L475), M484 (= M477), V485 (= V478), W488 (= W481), H557 (≠ A543)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D287), R291 (= R288), W488 (= W481), S567 (≠ P553)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R159), G221 (= G216), G222 (= G217), G223 (= G218), T245 (= T242), L246 (= L243), M247 (≠ R244), L263 (= L260), G264 (= G261), M265 (= M262), H266 (= H263), G285 (= G282), R287 (= R284), D289 (= D286), R291 (= R288), D309 (= D306), I310 (≠ A307), G327 (= G324), D328 (≠ N325), V329 (= V326), M404 (= M397), G422 (= G415)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ S474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V392), G400 (= G393), Q401 (= Q394), H402 (= H395), M427 (= M420), G451 (= G444), D452 (= D445), G453 (= G446), S454 (= S447), N479 (= N472), H481 (≠ S474), L482 (= L475), G483 (= G476), M484 (= M477), V485 (= V478)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 10:579/582 of 3e9yA
- active site: Y32 (= Y32), G34 (= G34), G35 (= G35), A36 (≠ T36), S37 (≠ I37), E58 (= E57), T81 (= T80), F120 (= F119), Q121 (= Q120), E122 (= E121), K170 (= K169), M265 (= M262), V292 (≠ A289), V399 (= V392), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ S474), L482 (= L475), M484 (= M477), V485 (= V478), W488 (= W481), H557 (≠ A543)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D287), R291 (= R288), W488 (= W481), S567 (≠ P553)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R159), G221 (= G216), G222 (= G217), G223 (= G218), T245 (= T242), L246 (= L243), M247 (≠ R244), L263 (= L260), G285 (= G282), R287 (= R284), D289 (= D286), R291 (= R288), D309 (= D306), I310 (≠ A307), G327 (= G324), D328 (≠ N325), V329 (= V326), M404 (= M397), G422 (= G415)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ S474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V392), G400 (= G393), Q401 (= Q394), H402 (= H395), M427 (= M420), G451 (= G444), G453 (= G446), S454 (= S447), N479 (= N472), H481 (≠ S474), L482 (= L475), G483 (= G476), M484 (= M477), V485 (= V478)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), R292 (= R288), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415)
- binding magnesium ion: F370 (≠ Y362), D453 (= D445), M458 (= M450), Q461 (= Q453), N480 (= N472), H482 (≠ S474), K533 (≠ R518)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M262), R292 (= R288), M485 (= M477), W489 (= W481), S568 (≠ P553)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 5wj1A
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), M263 (= M259), L264 (= L260), G286 (= G282), R288 (= R284), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M262), D291 (= D287), R292 (= R288), M485 (= M477), W489 (= W481), S568 (≠ P553)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 5k6tA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H263), R292 (= R288), M485 (= M477), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), G286 (= G282), R288 (= R284), D290 (= D286), R292 (= R288), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), Q404 (= Q396), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), G452 (= G444), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 5k6rA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R288), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), M266 (= M262), G286 (= G282), R288 (= R284), R292 (= R288), V293 (≠ A289), D310 (= D306), I311 (≠ A307), G328 (= G324), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1z8nA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K133), R161 (= R159), Y191 (≠ H182), R194 (≠ E188), D291 (= D287), R292 (= R288), D312 (= D308), W489 (= W481), G569 (vs. gap)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), G265 (= G261), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), R292 (= R288), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472)
- binding thiamine diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), G426 (= G418), M428 (= M420), G452 (= G444), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1yi1A
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D287), R292 (= R288), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), M263 (= M259), L264 (= L260), G265 (= G261), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1yi0A
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D287), R292 (= R288), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), G265 (= G261), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), R292 (= R288), V293 (≠ A289), D310 (= D306), I311 (≠ A307), G328 (= G324), D329 (≠ N325), V330 (= V326), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1yhzA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D287), R292 (= R288), M485 (= M477), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1yhyA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D287), R292 (= R288), V486 (= V478), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), G265 (= G261), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/582 of 1ybhA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M262), D291 (= D287), R292 (= R288), M485 (= M477), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), M266 (= M262), H267 (= H263), G286 (= G282), V287 (≠ A283), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (≠ A416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
45% identity, 96% coverage: 10:564/578 of query aligns to 11:580/585 of 5k2oA
- active site: Y33 (= Y32), G35 (= G34), G36 (= G35), A37 (≠ T36), S38 (≠ I37), E59 (= E57), T82 (= T80), F121 (= F119), Q122 (= Q120), E123 (= E121), K171 (= K169), M266 (= M262), V293 (≠ A289), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ S474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ A543)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M262), R292 (= R288), W489 (= W481), S568 (≠ P553)
- binding flavin-adenine dinucleotide: R161 (= R159), G222 (= G216), G223 (= G217), G224 (= G218), T246 (= T242), L247 (= L243), M248 (≠ R244), L264 (= L260), G286 (= G282), R288 (= R284), D290 (= D286), V293 (≠ A289), D310 (= D306), I311 (≠ A307), D329 (≠ N325), V330 (= V326), Q404 (= Q396), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ S474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (= H395), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ S474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
6vz8D Arabidopsis thaliana acetohydroxyacid synthase complex with valine bound (see paper)
45% identity, 92% coverage: 10:539/578 of query aligns to 10:527/531 of 6vz8D
- active site: Y32 (= Y32), G34 (= G34), G35 (= G35), A36 (≠ T36), S37 (≠ I37), E58 (= E57), T81 (= T80), F120 (= F119), Q121 (= Q120), E122 (= E121), K170 (= K169), M256 (= M262), V283 (≠ A289), V376 (= V392), G402 (= G418), M404 (= M420), D429 (= D445), N456 (= N472), H458 (≠ S474), L459 (= L475), M461 (= M477), V462 (= V478), W465 (= W481)
- binding flavin-adenine dinucleotide: G214 (= G216), G215 (= G217), G216 (= G218), T236 (= T242), L237 (= L243), L254 (= L260), H257 (= H263), R278 (= R284), R282 (= R288), V283 (≠ A289), I291 (≠ A307), G399 (= G415)
- binding magnesium ion: H458 (≠ S474), L459 (= L475), G460 (= G476)
- binding thiamine diphosphate: E58 (= E57), P84 (= P83), V376 (= V392), G377 (= G393), Q378 (= Q394), H379 (= H395), G402 (= G418), M404 (= M420), G428 (= G444), D429 (= D445), G430 (= G446), S431 (= S447), L459 (= L475), G460 (= G476), M461 (= M477), V462 (= V478)
Query Sequence
>WP_057509298.1 NCBI__GCF_001431535.1:WP_057509298.1
MNIPAQRSAPPNGARWLTQALEAEGVQTLFGYPGGTIMPFYDALVDSRLKHVLVRHEQGA
ALAANGFARASGRVGVCIATSGPGASNLVTGIADAMLDSVPMVCITGQVATPLLGTDAFQ
ELDVFGLTLPIVKHSWLVRSVDDLPRVVAEAFRIAREGRPGPVLIDLPKDVQVADASHLP
AHVPATVEAPPAPAEQAIADAIAAIAGAEKPVIYAGGGIALGDAVDALRDFAAASGIPAV
LTLRGLGALPAGHPQSLGMLGMHGTRAANMAVQEADLLLVLGARFDDRATGKLTEFAPFA
RVVHIDADAYEISKLRTADVAVPGNVAQAIRALHAAFPAPPATQAAWRNRCAQHREKFIA
RYDAPGKHIYAPALLKRLSELAPADAVIACDVGQHQMWVAQHCRFNHPRNHLTSGALGTM
GFGLPAAMGAQFACPDRTVVLVSGDGSFMMNVQELTTIARCRLPVKIVLLDNSSLGMVRQ
WQELFFAERYSEIDLSDNPDFVALAKVFGIAATRIDARDDVEGGLAALLAEPGPALLHVA
IDARANVWPLVPPNTANSTMLESNPAHVSQETPNAIPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory