Comparing WP_057509307.1 NCBI__GCF_001431535.1:WP_057509307.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
40% identity, 98% coverage: 5:380/382 of query aligns to 4:376/378 of O32445
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
40% identity, 98% coverage: 5:380/382 of query aligns to 5:377/379 of 3iv8A
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
41% identity, 98% coverage: 5:378/382 of query aligns to 4:377/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
41% identity, 98% coverage: 5:378/382 of query aligns to 4:377/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
41% identity, 98% coverage: 5:378/382 of query aligns to 4:377/382 of 2p53A
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
41% identity, 98% coverage: 5:378/382 of query aligns to 4:376/381 of 1yrrA
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
40% identity, 98% coverage: 5:378/382 of query aligns to 4:351/356 of 2p50B
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
37% identity, 95% coverage: 21:381/382 of query aligns to 27:384/385 of 6jkuA
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
38% identity, 98% coverage: 5:378/382 of query aligns to 3:329/334 of 1yrrB
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
37% identity, 97% coverage: 7:378/382 of query aligns to 12:394/401 of 7nutA
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
33% identity, 95% coverage: 15:378/382 of query aligns to 15:358/363 of 1o12A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
39% identity, 97% coverage: 10:379/382 of query aligns to 11:378/385 of 6fv4B
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
39% identity, 97% coverage: 10:379/382 of query aligns to 11:378/381 of 6fv4A
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
32% identity, 91% coverage: 24:370/382 of query aligns to 25:376/393 of 2vhlB
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
32% identity, 91% coverage: 24:370/382 of query aligns to 26:377/396 of O34450
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
39% identity, 78% coverage: 10:308/382 of query aligns to 9:303/350 of 6fv3D
1pokA Crystal structure of isoaspartyl dipeptidase (see paper)
30% identity, 36% coverage: 11:147/382 of query aligns to 17:150/377 of 1pokA
Sites not aligning to the query:
1ybqA Crystal structure of escherichia coli isoaspartyl dipeptidase mutant d285n complexed with beta-aspartylhistidine (see paper)
30% identity, 36% coverage: 11:147/382 of query aligns to 17:150/389 of 1ybqA
Sites not aligning to the query:
1pojA Isoaspartyl dipeptidase with bound inhibitor (see paper)
30% identity, 36% coverage: 11:147/382 of query aligns to 17:150/388 of 1pojA
Sites not aligning to the query:
1onxA Crystal structure of isoaspartyl dipeptidase from escherichia coli complexed with aspartate (see paper)
30% identity, 36% coverage: 11:147/382 of query aligns to 17:150/389 of 1onxA
Sites not aligning to the query:
>WP_057509307.1 NCBI__GCF_001431535.1:WP_057509307.1
MKQVLRNARMLVGDEFRDDLALVIEDGRILAVLPDAAPQLGQADEQVDLGGGWLLPGFID
VQVNGGGGALFNNTPDVATLRTIAAAHRRFGTTALLPTLISDDLQVMRAAIAATHDAIAQ
QVPGVIGIHLEGPYIAPARKGTHDVSKFRVPDADEIALAASLDNGVTLLTLAPERVPLET
IRALVERGVIVAAGHTAASYEEVRAGLDAGIRGFTHLYNAMSPLQGREPGAVGAALEDRD
SWVGIIVDGVHVHPGSLRVALAAKPRGRLLLVTDAMPPVGADDPSYELYGEIITAVDGVV
RNAAGSLAGSALDMATAVRNTVQLLGQPLAEAARMASTYPARFLNVDDRLGHIAEGFQAD
LVLLDDALQVRGTWIAGQYEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory