SitesBLAST
Comparing WP_057509308.1 NCBI__GCF_001431535.1:WP_057509308.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
46% identity, 98% coverage: 8:342/342 of query aligns to 4:333/333 of 8fdbB
- binding 2-deoxy-2-amino glucitol-6-phosphate: R49 (= R53), R49 (= R53), G50 (= G54), S51 (= S55), S52 (= S56), Y61 (= Y65), A75 (≠ S79), P76 (= P80), S77 (= S81), S97 (= S101), Q98 (= Q102), S99 (= S103), R211 (= R215), Y215 (≠ L219), K224 (= K228), E227 (= E231), S237 (= S241)
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
46% identity, 98% coverage: 8:342/342 of query aligns to 3:332/332 of 8fdbA
- binding 2-deoxy-2-amino glucitol-6-phosphate: R48 (= R53), R48 (= R53), G49 (= G54), S50 (= S55), S51 (= S56), D52 (= D57), Y60 (= Y65), A74 (≠ S79), P75 (= P80), S76 (= S81), S96 (= S101), Q97 (= Q102), S98 (= S103), V147 (= V152), A148 (= A153), A149 (= A154), R210 (= R215), Y214 (≠ L219), K223 (= K228), E226 (= E231), S236 (= S241)
- binding magnesium ion: G47 (≠ A52), R48 (= R53), Y60 (= Y65), I95 (= I100), S96 (= S101), R210 (= R215), Y214 (≠ L219)
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
46% identity, 94% coverage: 8:330/342 of query aligns to 2:319/319 of 8eymA
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: R47 (= R53), D51 (= D57), Y59 (= Y65), A71 (≠ S77), A72 (= A78), P74 (= P80), S75 (= S81), R209 (= R215), S235 (= S241), E238 (= E244)
- binding 2-deoxy-2-amino glucitol-6-phosphate: G48 (= G54), S49 (= S55), S95 (= S101), Q96 (= Q102), A147 (= A153), A148 (= A154), K222 (= K228), E225 (= E231)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 55:361/366 of 1morA
- active site: E239 (= E224), K243 (= K228), E246 (= E231), H262 (= H247), K361 (= K337)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S55), S105 (= S101), Q106 (= Q102), S107 (= S103), T110 (≠ S106), V157 (= V152), A360 (≠ N336), K361 (= K337)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 55:361/366 of 1moqA
- active site: E239 (= E224), K243 (= K228), E246 (= E231), H262 (= H247), K361 (= K337)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S55), S61 (= S56), S105 (= S101), Q106 (= Q102), S107 (= S103), T110 (≠ S106), V157 (= V152), A360 (≠ N336), K361 (= K337)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 56:362/367 of 1mosA
- active site: E240 (= E224), K244 (= K228), E247 (= E231), H263 (= H247), K362 (= K337)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (≠ S55), S62 (= S56), S106 (= S101), Q107 (= Q102), S108 (= S103), T111 (≠ S106), K244 (= K228), E247 (= E231)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 297:603/608 of 4amvA
- active site: E481 (= E224), K485 (= K228), E488 (= E231), H504 (= H247), K603 (= K337)
- binding fructose -6-phosphate: G301 (= G54), T302 (≠ S55), S303 (= S56), S347 (= S101), Q348 (= Q102), S349 (= S103), T352 (≠ S106), S401 (≠ A154), K485 (= K228), E488 (= E231)
Sites not aligning to the query:
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 297:603/608 of 1jxaA
- active site: E481 (= E224), K485 (= K228), E488 (= E231), H504 (= H247), K603 (= K337)
- binding glucose-6-phosphate: T302 (≠ S55), S303 (= S56), S347 (= S101), Q348 (= Q102), S349 (= S103), T352 (≠ S106), S401 (≠ A154), K485 (= K228), E488 (= E231)
Sites not aligning to the query:
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
29% identity, 85% coverage: 48:337/342 of query aligns to 297:603/608 of 2j6hA
- active site: E481 (= E224), K485 (= K228), E488 (= E231), H504 (= H247), K603 (= K337)
- binding glucose-6-phosphate: T302 (≠ S55), S347 (= S101), Q348 (= Q102), S349 (= S103), T352 (≠ S106), V399 (= V152), S401 (≠ A154), E488 (= E231)
Sites not aligning to the query:
- active site: 1, 26, 27, 74, 98, 99, 248
- binding 5-oxo-l-norleucine: 1, 73, 74, 76, 86, 98, 99, 123
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
29% identity, 83% coverage: 48:332/342 of query aligns to 55:356/357 of 7dnrA
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 91% coverage: 26:337/342 of query aligns to 33:360/365 of 2zj4A
- active site: E238 (= E224), K242 (= K228), E245 (= E231), H261 (= H247), K360 (= K337)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (≠ S55), S61 (= S56), S105 (= S101), Q106 (= Q102), S107 (= S103), T110 (≠ S106), V156 (= V152), A157 (= A153), K242 (= K228), E245 (= E231)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
25% identity, 91% coverage: 26:337/342 of query aligns to 33:360/365 of 2zj3A
- active site: E238 (= E224), K242 (= K228), E245 (= E231), H261 (= H247), K360 (= K337)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (≠ S55), S61 (= S56), S105 (= S101), Q106 (= Q102), S107 (= S103), T110 (≠ S106), V156 (= V152), A359 (≠ N336), K360 (= K337)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
25% identity, 91% coverage: 26:337/342 of query aligns to 331:658/663 of 6r4eA
- active site: E536 (= E224), K540 (= K228), E543 (= E231), H559 (= H247), K658 (= K337)
- binding glucose-6-phosphate: T358 (≠ S55), S359 (= S56), S403 (= S101), Q404 (= Q102), S405 (= S103), T408 (≠ S106), S456 (≠ A154), K540 (= K228), E543 (= E231)
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
25% identity, 91% coverage: 26:337/342 of query aligns to 328:655/660 of 6svmA
- active site: E533 (= E224), K537 (= K228), E540 (= E231), H556 (= H247), K655 (= K337)
- binding glucose-6-phosphate: C353 (= C51), T355 (≠ S55), S356 (= S56), S400 (= S101), Q401 (= Q102), S402 (= S103), T405 (≠ S106), S453 (≠ A154), K537 (= K228), E540 (= E231)
- binding magnesium ion: S434 (≠ A135), R435 (≠ Q136), T437 (≠ A138)
- binding uridine-diphosphate-n-acetylgalactosamine: G334 (≠ V32), G424 (≠ A125), T426 (≠ V127), S434 (≠ A135), T437 (≠ A138), C439 (≠ T140), G440 (≠ V141), V441 (≠ L142), H442 (≠ P143)
Sites not aligning to the query:
- active site: 7, 32, 95, 122, 123
- binding glutamic acid: 1, 94, 95, 97, 107, 123, 147
- binding uridine-diphosphate-n-acetylgalactosamine: 289, 322
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
25% identity, 91% coverage: 26:337/342 of query aligns to 367:694/699 of Q06210
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
24% identity, 91% coverage: 26:335/342 of query aligns to 327:652/652 of 6r4gA
- active site: E532 (= E224), K536 (= K228), E539 (= E231), H555 (= H247)
- binding glucose-6-phosphate: G353 (= G54), T354 (≠ S55), S355 (= S56), S399 (= S101), Q400 (= Q102), S401 (= S103), T404 (≠ S106), S452 (≠ A154), E539 (= E231)
- binding magnesium ion: S433 (≠ A135), R434 (≠ Q136), T436 (≠ A138)
- binding uridine-diphosphate-n-acetylglucosamine: G333 (≠ V32), G423 (≠ A125), T425 (≠ V127), S433 (≠ A135), T436 (≠ A138), C438 (≠ T140), G439 (≠ V141), V440 (≠ L142), H441 (≠ P143)
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
26% identity, 75% coverage: 26:282/342 of query aligns to 32:295/352 of 2v4mA
- active site: E237 (= E224), K241 (= K228), E244 (= E231), H260 (= H247)
- binding fructose -6-phosphate: T59 (≠ S55), S60 (= S56), S104 (= S101), Q105 (= Q102), S106 (= S103), T109 (≠ S106), A156 (= A153), S157 (≠ A154), K241 (= K228), E244 (= E231)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
28% identity, 59% coverage: 92:294/342 of query aligns to 93:306/352 of 2pocB
- active site: E236 (= E224), K240 (= K228), E243 (= E231), H259 (= H247)
- binding 6-O-phosphono-beta-D-glucopyranose: S102 (= S101), Q103 (= Q102), S104 (= S103), T107 (≠ S106), E243 (= E231)
- binding uridine-diphosphate-n-acetylglucosamine: G126 (≠ A125), V128 (= V127), S136 (≠ A135), T139 (≠ A138), C141 (≠ T140), G142 (≠ V141), V143 (≠ L142), H144 (≠ P143)
Sites not aligning to the query:
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 98% coverage: 3:337/342 of query aligns to 348:712/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
25% identity, 59% coverage: 92:294/342 of query aligns to 93:296/339 of 2putA
- active site: E236 (= E224), K240 (= K228), E243 (= E231)
- binding fructose -6-phosphate: S102 (= S101), Q103 (= Q102), S104 (= S103), T107 (≠ S106), A154 (= A153), S155 (≠ A154), K240 (= K228)
- binding uridine-diphosphate-n-acetylglucosamine: G126 (≠ A125), V128 (= V127), S136 (≠ A135), T139 (≠ A138), C141 (≠ T140), G142 (≠ V141), V143 (≠ L142), H144 (≠ P143)
Sites not aligning to the query:
Query Sequence
>WP_057509308.1 NCBI__GCF_001431535.1:WP_057509308.1
MTLPAPADTLMFREAAEAADVIAAQFARNHGVMETLAASLRAAPPPFVVTCARGSSDHAA
TYAKYLLETQLGLVVASASPSVGSVYAAALHLRGALFIVISQSGKSPDLLRNAEAAKAAG
ARVVALVNVEDSPLAQLADTVLPLHAGAERSVAATKSYLASLAAVLQLAAYWKQDSALRA
ALDALPAALRQAWQADWSTVTEGLVEASNLFVLGRGLGLGAAQEAALKFKETCGLHAEAY
SSAEVKHGPMALVGPGFPVLAFAQPDETGAGTRAVADEFAARGAQVWLAGAGGDLPVAAA
PHPLCAPLLTVQSFYRAINALALRRGHNPDLPPHLNKVTETV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory