Comparing WP_057509365.1 NCBI__GCF_001431535.1:WP_057509365.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
51% identity, 89% coverage: 9:204/219 of query aligns to 4:199/201 of 3m3mA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
48% identity, 90% coverage: 8:205/219 of query aligns to 2:199/206 of 4hz2B
5hfkA Crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. Sakai (ecs3186, target efi-507414) with bound glutathione
35% identity, 83% coverage: 18:199/219 of query aligns to 11:197/207 of 5hfkA
Sites not aligning to the query:
P77526 Disulfide-bond oxidoreductase YfcG; GSH-dependent disulfide-bond oxidoreductase YfcG; GST N1-1; GST-like protein YfcG; Organic hydroperoxidase; EC 1.8.4.-; EC 1.11.1.- from Escherichia coli (strain K12) (see 2 papers)
35% identity, 83% coverage: 18:199/219 of query aligns to 11:197/215 of P77526
Sites not aligning to the query:
3gx0A Crystal structure of gsh-dependent disulfide bond oxidoreductase (see paper)
35% identity, 83% coverage: 18:199/219 of query aligns to 11:197/204 of 3gx0A
Sites not aligning to the query:
4l8eA Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
32% identity, 83% coverage: 18:199/219 of query aligns to 10:196/203 of 4l8eA
Sites not aligning to the query:
4nhzH Crystal structure of glutathione transferase bbta-3750 from bradyrhizobium sp., Target efi-507290, with one glutathione bound
34% identity, 83% coverage: 18:199/219 of query aligns to 42:234/246 of 4nhzH
Sites not aligning to the query:
1k0cC Ure2p in complex with s-p-nitrobenzylglutathione (see paper)
27% identity, 89% coverage: 7:202/219 of query aligns to 14:233/239 of 1k0cC
4ikhA Crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound
31% identity, 70% coverage: 18:171/219 of query aligns to 26:185/227 of 4ikhA
Sites not aligning to the query:
4mf6A Crystal structure of glutathione transferase bgramdraft_1843 from burkholderia graminis, target efi-507289, with two glutathione molecules bound per one protein subunit
32% identity, 87% coverage: 18:208/219 of query aligns to 36:231/240 of 4mf6A
Sites not aligning to the query:
4zb6D Crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione. (see paper)
25% identity, 94% coverage: 8:213/219 of query aligns to 5:219/220 of 4zb6D
1k0aA Ure2p in complex with s-hexylglutathione (see paper)
29% identity, 89% coverage: 7:202/219 of query aligns to 14:228/234 of 1k0aA
1k0cA Ure2p in complex with s-p-nitrobenzylglutathione (see paper)
27% identity, 89% coverage: 7:202/219 of query aligns to 12:225/228 of 1k0cA
4naxA Crystal structure of glutathione transferase pput_1760 from pseudomonas putida, target efi-507288, with one glutathione disulfide bound per one protein subunit
32% identity, 71% coverage: 18:172/219 of query aligns to 28:187/237 of 4naxA
Sites not aligning to the query:
1jzrA Ure2p in complex with glutathione (see paper)
29% identity, 89% coverage: 7:202/219 of query aligns to 14:229/234 of 1jzrA
4ecjA Crystal structure of glutathione s-transferase prk13972 (target efi- 501853) from pseudomonas aeruginosa pacs2 complexed with glutathione
31% identity, 83% coverage: 18:199/219 of query aligns to 12:193/204 of 4ecjA
Sites not aligning to the query:
4kh7B Crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione
29% identity, 92% coverage: 8:208/219 of query aligns to 6:212/212 of 4kh7B
4zbbA Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium complexed with glutathionyl-s- dinitrobenzene. (see paper)
27% identity, 90% coverage: 3:199/219 of query aligns to 4:206/221 of 4zbbA
4zbaA Crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium with oxidized glutathione. (see paper)
27% identity, 90% coverage: 3:199/219 of query aligns to 4:206/222 of 4zbaA
6tahB Glutathione S-transferase
29% identity, 83% coverage: 18:199/219 of query aligns to 13:194/213 of 6tahB
Sites not aligning to the query:
>WP_057509365.1 NCBI__GCF_001431535.1:WP_057509365.1
MSDERIGLTVHGMSVSGNCHKVRLLLEQLGTRYRWVEVDSAHGQTHAPEFLALNPNAKVP
VVVRDDGRVLPESNAILFWLAEGTPFLSSDGWERAQTLRWMFFEQYSHEPYVAVARFICG
WTGADSPRRAELPRLRERSAAALAVMEQHLGHARWFSGAAYGIADIALFAYTDVAGDGGV
SLQPYPAVVAWLQRVRSQPGFVAMPEVTAEVRARFDQAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory