SitesBLAST
Comparing WP_057687222.1 NCBI__GCF_001431535.1:WP_057687222.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
70% identity, 94% coverage: 17:398/405 of query aligns to 1:382/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H97), K82 (= K98), Q109 (= Q125), S185 (≠ T201), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), E345 (= E361), S371 (= S387), G372 (= G388)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
61% identity, 97% coverage: 13:404/405 of query aligns to 5:399/399 of 5ocwB
- active site: K93 (= K98), E115 (= E120), S382 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H97), K93 (= K98), T116 (= T121), G117 (= G122), A118 (= A123), Q120 (= Q125), H121 (= H126), T196 (= T201), G238 (= G243), G240 (= G245), S241 (= S246), N242 (= N247), G309 (= G314), E356 (= E361), S382 (= S387)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
61% identity, 97% coverage: 13:404/405 of query aligns to 10:404/406 of 5tciH
- active site: K98 (= K98), E120 (= E120), S387 (= S387)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (≠ A28), L31 (= L31), Y197 (= Y197), F199 (≠ I199), P205 (= P205), F208 (≠ Y208), H291 (= H291)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
61% identity, 97% coverage: 13:404/405 of query aligns to 10:404/405 of 6u6cB
- active site: K98 (= K98), E120 (= E120), S387 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H97), K98 (= K98), T121 (= T121), G122 (= G122), A123 (= A123), Q125 (= Q125), H126 (= H126), T201 (= T201), G243 (= G243), G245 (= G245), S246 (= S246), N247 (= N247), G314 (= G314), E361 (= E361), S387 (= S387)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (≠ F26), F185 (≠ M185), W188 (= W188), Y197 (= Y197), F199 (≠ I199), G204 (= G204), P205 (= P205), H291 (= H291), G292 (= G292)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
61% identity, 97% coverage: 13:404/405 of query aligns to 9:403/405 of 6uapB
- active site: K97 (= K98), E119 (= E120), S386 (= S387)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ L181), N181 (= N182), F184 (≠ M185), Y196 (= Y197), F198 (≠ I199), P204 (= P205), F207 (≠ Y208), H290 (= H291)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
61% identity, 97% coverage: 13:404/405 of query aligns to 9:403/404 of 6usaB
- active site: K97 (= K98), E119 (= E120), S386 (= S387)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H97), K97 (= K98), T120 (= T121), G121 (= G122), A122 (= A123), G123 (= G124), Q124 (= Q125), H125 (= H126), T200 (= T201), G242 (= G243), G244 (= G245), S245 (= S246), N246 (= N247), G313 (= G314), E360 (= E361), S386 (= S387)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ M185), W187 (= W188), Y196 (= Y197), F198 (≠ I199), G203 (= G204), P204 (= P205), F207 (≠ Y208), H290 (= H291), G291 (= G292)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
61% identity, 97% coverage: 13:404/405 of query aligns to 9:403/404 of 6dweB
- active site: K97 (= K98), E119 (= E120), S386 (= S387)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ M185), Y196 (= Y197), F198 (≠ I199), P204 (= P205), F207 (≠ Y208), H290 (= H291)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H97), K97 (= K98), T120 (= T121), G121 (= G122), A122 (= A123), G123 (= G124), Q124 (= Q125), H125 (= H126), T200 (= T201), G242 (= G243), G244 (= G245), S245 (= S246), N246 (= N247), G313 (= G314), E360 (= E361), S386 (= S387)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:381/385 of 6am8B
- active site: K82 (= K98), E104 (= E120), S371 (= S387)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H97), K82 (= K98), E104 (= E120), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), L161 (= L177), S185 (≠ T201), V187 (≠ A203), G227 (= G243), G228 (= G244), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), Y301 (= Y317), E345 (= E361), S371 (= S387), G372 (= G388)
- binding tryptophan: P12 (≠ A28), L169 (≠ M185), S274 (≠ L290), H275 (= H291)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
59% identity, 95% coverage: 19:402/405 of query aligns to 3:386/388 of 5dw0A
- active site: K82 (= K98), E104 (= E120), S371 (= S387)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), D300 (= D316), E345 (= E361), S371 (= S387)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 95% coverage: 19:402/405 of query aligns to 3:386/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
59% identity, 95% coverage: 19:402/405 of query aligns to 3:386/386 of 1v8zA
- active site: K82 (= K98), E104 (= E120), S371 (= S387)
- binding pyridoxal-5'-phosphate: H81 (= H97), K82 (= K98), Q109 (= Q125), S185 (≠ T201), G227 (= G243), G228 (= G244), G229 (= G245), S230 (= S246), N231 (= N247), E345 (= E361), S371 (= S387), G372 (= G388)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:381/384 of 7rnpA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
59% identity, 96% coverage: 19:405/405 of query aligns to 3:387/394 of 5ixjD
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:381/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), E345 (= E361), S371 (= S387)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:381/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G298 (= G314), E345 (= E361), S371 (= S387)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:379/383 of 5vm5D
- active site: K82 (= K98), E104 (= E120), S369 (= S387)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G227 (= G243), G229 (= G245), S230 (= S246), N231 (= N247), G296 (= G314), E343 (= E361), S369 (= S387)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:380/383 of 5dw3A
- active site: K82 (= K98), E104 (= E120), S370 (= S387)
- binding tryptophan: K82 (= K98), E104 (= E120), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G228 (= G244), Y300 (= Y317)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 94% coverage: 19:397/405 of query aligns to 3:379/383 of 5t6mA
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
59% identity, 94% coverage: 16:397/405 of query aligns to 1:377/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H97), K82 (= K98), T105 (= T121), G106 (= G122), A107 (= A123), Q109 (= Q125), H110 (= H126), S185 (≠ T201), G229 (= G245), S230 (= S246), N231 (= N247), G297 (= G314), E344 (= E361), S367 (= S387)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
59% identity, 94% coverage: 17:397/405 of query aligns to 1:376/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H97), K81 (= K98), T104 (= T121), G105 (= G122), A106 (= A123), Q108 (= Q125), H109 (= H126), S184 (≠ T201), G228 (= G245), S229 (= S246), N230 (= N247), G296 (= G314), E343 (= E361), S366 (= S387), G367 (= G388)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L177), I164 (≠ L181), Y180 (= Y197), P182 (≠ I199), G183 (= G200), S184 (≠ T201), V186 (≠ A203), Y299 (= Y317)
Query Sequence
>WP_057687222.1 NCBI__GCF_001431535.1:WP_057687222.1
MSLPPIPDFHAYPDANGHFGRYGGSFVAETLVGPLQELAAAYDQARKDPAFIAEYDHDLA
HYVGRPSPIYHARRLSDHVGGAQILLKREDLNHTGAHKINNTIGQALLASRMGKKRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLLEYGRLPDAITA
CVGGGSNAIGLFHAFLNDREVQIFGAEAAGDGIETGRHAASIAAGRPGVLHGNRTYVLCD
DDGQIIETHSVSAGLDYPGVGPEHAFLADSGRATYLGITDEEALQAFHLLSRTEGILAAL
ESSHALAQAIKLARERPRDQLVLCNLSGRGDKDVHTIAAREGLIL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory