Comparing WP_057687245.1 NCBI__GCF_001431535.1:WP_057687245.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
37% identity, 97% coverage: 4:410/418 of query aligns to 2:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
37% identity, 97% coverage: 4:410/418 of query aligns to 2:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
35% identity, 97% coverage: 4:407/418 of query aligns to 8:407/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
23% identity, 64% coverage: 1:267/418 of query aligns to 11:263/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
23% identity, 64% coverage: 1:267/418 of query aligns to 12:264/456 of 5j7iB
Sites not aligning to the query:
>WP_057687245.1 NCBI__GCF_001431535.1:WP_057687245.1
MSDIEGQARACRAAATVVAGLDTVQRTALLQSMAAALESHAGQILAANARDLAAARDKGI
GSAMLDRLMLDPPRLFAMAQALRDVAGLPDPVGQVTRDDVRPNGIRVQKVRVPLGVIAMI
YEARPNVTAEAAALCLKAGNGVILRGGSEAIHSNTAIAAALGSALPAHGVPEAAVTVLTD
LRREAMLELLQLHDLIDLAIPRGGEGLIRFVAEHARVPVIKHYKGVCHLFVDASADIDQA
IDLLVDGKCSRPSACNSLETLLVHRDVAAEFLPRAGQALAARGVELRADALSLPLLAGST
AATDEDYAAEFLDLVIAVKVVDDLEAAITHIRRYTSDHTEVIATRDADHAERFIHALQSA
VVMVNASSRFSDGGQLGLGSEIGISTTRLHAYGPMGLEALTVERFVVRGEGQVRTAKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory