Comparing WP_057687247.1 NCBI__GCF_001431535.1:WP_057687247.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 95% coverage: 17:385/387 of query aligns to 1:365/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 95% coverage: 19:385/387 of query aligns to 1:363/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 95% coverage: 19:385/387 of query aligns to 1:323/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 95% coverage: 19:385/387 of query aligns to 1:321/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 56% coverage: 21:235/387 of query aligns to 1:204/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
31% identity, 64% coverage: 21:267/387 of query aligns to 13:254/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
33% identity, 64% coverage: 21:267/387 of query aligns to 13:232/236 of 7f5xA
8j0gB Gk monomer complexes with glutamate and atp
30% identity, 65% coverage: 18:270/387 of query aligns to 5:268/274 of 8j0gB
8j0eB Gk monomer complexes with catalytic intermediate
29% identity, 65% coverage: 18:270/387 of query aligns to 8:263/269 of 8j0eB
8j0fA Gk tetramer with adjacent hooks at reaction state
29% identity, 65% coverage: 19:270/387 of query aligns to 10:262/270 of 8j0fA
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
31% identity, 28% coverage: 163:270/387 of query aligns to 120:224/225 of Q8U122
Sites not aligning to the query:
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
31% identity, 28% coverage: 163:270/387 of query aligns to 121:225/226 of 2bmuB
Sites not aligning to the query:
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
29% identity, 28% coverage: 163:270/387 of query aligns to 122:218/219 of 2ji5A
Sites not aligning to the query:
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
33% identity, 24% coverage: 125:217/387 of query aligns to 167:263/468 of 3c1mC
Sites not aligning to the query:
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
33% identity, 24% coverage: 125:217/387 of query aligns to 166:262/458 of 3c1nA
Sites not aligning to the query:
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
33% identity, 24% coverage: 125:217/387 of query aligns to 167:263/464 of 2hmfA
Sites not aligning to the query:
3k56A Crystal structure of isopentenyl phosphate kinase from m. Jannaschii in complex with ipp beta-s (see paper)
26% identity, 36% coverage: 133:273/387 of query aligns to 128:260/260 of 3k56A
Sites not aligning to the query:
3k52A Crystal structure of isopentenyl phosphate kinase from m. Jannaschii in complex with ip (see paper)
26% identity, 36% coverage: 133:273/387 of query aligns to 128:260/260 of 3k52A
Sites not aligning to the query:
3k4yA Crystal structure of isopentenyl phosphate kinase from m. Jannaschii in complex with ipp (see paper)
26% identity, 36% coverage: 133:273/387 of query aligns to 128:260/260 of 3k4yA
Sites not aligning to the query:
Q60352 Isopentenyl phosphate kinase; IPK; EC 2.7.4.26 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
25% identity, 36% coverage: 133:273/387 of query aligns to 128:260/260 of Q60352
Sites not aligning to the query:
>WP_057687247.1 NCBI__GCF_001431535.1:WP_057687247.1
MIDPAAMTASPFPEQALPDWRRAVLKVGSSLLAADGGGLSPRHALGLAQFVSANVLAGRE
VVIVSSGAVAAGRAILPRVEAAGAAMAARQALAALGQAQLIGLWQRFFERPVAQVLLTHD
DLRNRRRYLNARATLNELLRLGALPVVNENDTVSVDELKLGDNDNLAATVAALVDADVLF
IATDIDGLYSADPRRDASAQPIPQVQELTADVLAMAGGSGSSAGTGGMRTKLEAASKAAR
LGIETILFNGRNGDVVRALAQGRLHGTRLHASQSREAARKYWLRHAPVEPGVIWIDDGAV
QAMRGKGASLLPGGITGADGEFRRGDMVEIRCRPGAGGGEASVARGVTQYAASDIRRIAG
RHSRDIEAALGYNYGGNVVHRDDLVLV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory