Comparing WP_057687251.1 NCBI__GCF_001431535.1:WP_057687251.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4kztA Structure mmnags bound with l-arginine (see paper)
53% identity, 97% coverage: 12:440/442 of query aligns to 1:429/431 of 4kztA
3s6hA Crystal structure of native mmnags/k (see paper)
53% identity, 97% coverage: 11:440/442 of query aligns to 4:433/436 of 3s6hA
4ab7H Crystal structure of a tetrameric acetylglutamate kinase from saccharomyces cerevisiae complexed with its substrate n- acetylglutamate (see paper)
41% identity, 92% coverage: 26:432/442 of query aligns to 2:416/422 of 4ab7H
3zzhC Crystal structure of the amino acid kinase domain from saccharomyces cerevisiae acetylglutamate kinase in complex with its feed- back inhibitor l-arginine (see paper)
50% identity, 64% coverage: 11:293/442 of query aligns to 5:288/288 of 3zzhC
Q8N159 N-acetylglutamate synthase, mitochondrial; Amino-acid acetyltransferase; EC 2.3.1.1 from Homo sapiens (Human) (see 4 papers)
35% identity, 90% coverage: 23:419/442 of query aligns to 115:504/534 of Q8N159
Sites not aligning to the query:
4nexA Structure of the n-acetyltransferase domain of x. Fastidiosa nags/k (see paper)
63% identity, 35% coverage: 286:441/442 of query aligns to 1:156/157 of 4nexA
2v5hB Controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 (see paper)
36% identity, 62% coverage: 16:291/442 of query aligns to 7:281/289 of 2v5hB
2bufA Arginine feed-back inhibitable acetylglutamate kinase (see paper)
30% identity, 62% coverage: 25:296/442 of query aligns to 11:291/292 of 2bufA
2ap9A Crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551
32% identity, 63% coverage: 16:295/442 of query aligns to 1:292/299 of 2ap9A
Sites not aligning to the query:
7nlxA Crystal structure of mycobacterium tuberculosis argb in complex with 7-(trifluoromethyl)quinolin-4-ol.
32% identity, 62% coverage: 19:294/442 of query aligns to 3:290/290 of 7nlxA
7nlnA Crystal structure of mycobacterium tuberculosis argb in complex with n-acetyl-glutamate
32% identity, 62% coverage: 19:294/442 of query aligns to 3:290/290 of 7nlnA
7nloA Crystal structure of mycobacterium tuberculosis argb in complex with l-arginine
32% identity, 62% coverage: 19:294/442 of query aligns to 2:289/289 of 7nloA
7nlpA Crystal structure of mycobacterium tuberculosis argb in complex with l-canavanine
32% identity, 63% coverage: 16:294/442 of query aligns to 2:292/292 of 7nlpA
7nnbA Crystal structure of mycobacterium tuberculosis argb in complex with 2,8-bis(trifluoromethyl)quinolin-4-ol.
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nnbA
7nn8A Crystal structure of mycobacterium tuberculosis argb in complex with 1h-indole-3-carbonitrile.
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nn8A
7nm0A Crystal structure of mycobacterium tuberculosis argb in complex with 1-(2,6-dihydroxyphenyl)ethan-1-one.
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nm0A
7nlzA Crystal structure of mycobacterium tuberculosis argb in complex with 5-methoxy-6-(trifluoromethyl)indole.
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nlzA
7nlyA Crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole.
32% identity, 63% coverage: 16:294/442 of query aligns to 3:293/293 of 7nlyA
7nltA Crystal structure of mycobacterium tuberculosis argb in complex with 4-(4-methylpiperazin-1-yl)benzoic acid
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nltA
7nlrA Crystal structure of mycobacterium tuberculosis argb in complex with 2-phenyl-1h-imidazole
32% identity, 63% coverage: 16:294/442 of query aligns to 1:291/291 of 7nlrA
>WP_057687251.1 NCBI__GCF_001431535.1:WP_057687251.1
MSPALQPHRQTRQTIVRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDLEAL
TSSLSFLQEVGLTPIVLHGAGPQLDTELAAAGIEKQTVNGLRVTSPEALAIVRQVFQQSN
LRLVEALQQNGARATSITGGVFEAEYMDQATYGLVGEVKKVNLAPIEASLRAGSIPVITS
LGETRSGQILNVNADFAANELVQELQPYKIIFLTGTGGLLDEEGKVIDSINLSTEYEHLM
TQPWIHGGMKVKIEQIKSLLDRLPLESSVSITRPADLAKELFTHKGSGTLVRKGERVLRA
TSWDELDLPRLRGLIESSFGRVLVPDYFDKTRLLRAYVSENYRTAVILTDEAEGVYLDKF
AVLDDAQGEGLGRAVWNVMLDETPQLFWRSRNGNPINHFYYAESDGCYKQGTWKTFWFGA
DGFDRIKAYVDHCAQRAPSLLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory