Comparing WP_057687252.1 NCBI__GCF_001431535.1:WP_057687252.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
87% identity, 99% coverage: 1:359/362 of query aligns to 4:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
86% identity, 99% coverage: 1:359/362 of query aligns to 5:358/360 of 2f7vA
7rsfA Acetylornithine deacetylase from escherichia coli
27% identity, 91% coverage: 31:358/362 of query aligns to 38:374/380 of 7rsfA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
27% identity, 57% coverage: 39:244/362 of query aligns to 37:258/377 of 7t1qA
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
26% identity, 89% coverage: 39:359/362 of query aligns to 39:373/377 of 7lgpB
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
28% identity, 65% coverage: 48:282/362 of query aligns to 2:241/392 of 7m6uB
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
28% identity, 65% coverage: 48:282/362 of query aligns to 67:306/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
28% identity, 65% coverage: 48:282/362 of query aligns to 92:331/415 of P06621
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
22% identity, 80% coverage: 68:356/362 of query aligns to 75:373/383 of 7uoiA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
22% identity, 88% coverage: 39:358/362 of query aligns to 37:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
21% identity, 88% coverage: 39:358/362 of query aligns to 41:375/380 of 5vo3A
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
24% identity, 62% coverage: 38:263/362 of query aligns to 56:295/408 of Q03154
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
31% identity, 32% coverage: 39:153/362 of query aligns to 39:167/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
27% identity, 50% coverage: 64:243/362 of query aligns to 100:294/426 of 3pfoA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
24% identity, 57% coverage: 39:244/362 of query aligns to 37:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
24% identity, 57% coverage: 39:244/362 of query aligns to 37:258/375 of 4pqaA
Sites not aligning to the query:
>WP_057687252.1 NCBI__GCF_001431535.1:WP_057687252.1
MLEQTLHHLQALVSFDTRNPPRAITTGGIFDYLRDNLPGFNVEVVDHGDGAVSLHAVRGA
PKYLFNVHLDTVPDSPHWSADPHVMRRLDDRVVGLGVCDIKGAAAALVAAANASEGDAAF
LFSSDEEANDPRCIAAFLARGLPYEAVLVAEPTMSEAVLAHRGISSVLMQFAGRAGHASG
KQDAAASALHQAMRWGNRALDHVDSLSTARFGGLTGLRFNIGRVEGGIKANMIAPAAELR
FGFRPLPSMDIDALLATFAGFAEPEAAVFTETFRGPSLPAGDIADAENRRLAARDVADAL
DLPIGNAVDFWTEASLFSAGGYTTLVFGPGDIAQAHTADEFVTLEQLQRYADAVHRIISA
GA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory