SitesBLAST
Comparing WP_057687434.1 NCBI__GCF_001431535.1:WP_057687434.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
59% identity, 58% coverage: 315:769/779 of query aligns to 6:453/463 of P26276
- R15 (= R324) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- Y17 (= Y326) binding ; binding
- R20 (= R329) mutation to A: No phosphoglucomutase activity.
- S108 (= S417) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N419) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D553) binding
- D244 (= D555) binding
- D246 (= D557) binding
- R247 (= R558) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (= R573) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (= K596) binding
- H308 (= H619) binding ; binding
- E325 (= E636) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (= EMSGH 636:640) binding ; binding
- H329 (= H640) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P679) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R737) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (= RASNT 737:741) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
59% identity, 58% coverage: 315:769/779 of query aligns to 6:453/463 of Q02E40
- S108 (= S417) active site, Non-phosphorylated intermediate; modified: Phosphoserine
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
59% identity, 58% coverage: 315:769/779 of query aligns to 1:448/458 of 1pcjX
- active site: R15 (= R329), S103 (= S417), H104 (= H418), K113 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640), D335 (= D651)
- binding 1-O-phosphono-alpha-D-mannopyranose: Y12 (= Y326), S103 (= S417), T301 (= T617), G302 (= G618), E320 (= E636), S322 (= S638), H324 (= H640), R416 (= R737), S418 (= S739), N419 (= N740), T420 (= T741)
- binding zinc ion: S103 (= S417), D237 (= D553), D239 (= D555), D241 (= D557)
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
59% identity, 58% coverage: 315:769/779 of query aligns to 2:449/459 of 1k2yX
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 2h5aX
- active site: H101 (= H418), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), D332 (= D651)
- binding 1-O-phosphono-alpha-D-xylopyranose: Y9 (= Y326), T298 (= T617), G299 (= G618), H300 (= H619), E317 (= E636), S319 (= S638), H321 (= H640), R413 (= R737), S415 (= S739), N416 (= N740), T417 (= T741)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 2h4lX
- active site: H101 (= H418), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), D332 (= D651)
- binding 1-O-phosphono-alpha-D-ribofuranose: Y9 (= Y326), R12 (= R329), S100 (= S417), T298 (= T617), E317 (= E636), R413 (= R737), S415 (= S739), N416 (= N740), T417 (= T741)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 2fkfA
- active site: R12 (= R329), S100 (= S417), H101 (= H418), K110 (= K427), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), H321 (= H640), D332 (= D651)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: R7 (= R324), H101 (= H418), S319 (= S638), R413 (= R737), S415 (= S739), N416 (= N740), T417 (= T741)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 1pcmX
- active site: R12 (= R329), S100 (= S417), H101 (= H418), K110 (= K427), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), H321 (= H640), D332 (= D651)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y326), S100 (= S417), T298 (= T617), G299 (= G618), H300 (= H619), E317 (= E636), S319 (= S638), H321 (= H640), R413 (= R737), S415 (= S739)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 1p5gX
- active site: R12 (= R329), S100 (= S417), H101 (= H418), K110 (= K427), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), H321 (= H640), D332 (= D651)
- binding 6-O-phosphono-alpha-D-glucopyranose: Y9 (= Y326), S100 (= S417), K277 (= K596), G299 (= G618), H300 (= H619), E317 (= E636), S319 (= S638), H321 (= H640), R413 (= R737), S415 (= S739), N416 (= N740), T417 (= T741)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
59% identity, 58% coverage: 318:769/779 of query aligns to 1:445/455 of 1p5dX
- active site: R12 (= R329), S100 (= S417), H101 (= H418), K110 (= K427), D234 (= D553), D236 (= D555), D238 (= D557), R239 (= R558), H321 (= H640), D332 (= D651)
- binding 1-O-phosphono-alpha-D-glucopyranose: Y9 (= Y326), S100 (= S417), R239 (= R558), T298 (= T617), G299 (= G618), H300 (= H619), E317 (= E636), S319 (= S638), H321 (= H640), R413 (= R737), S415 (= S739), T417 (= T741)
- binding zinc ion: S100 (= S417), D234 (= D553), D236 (= D555), D238 (= D557)
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
59% identity, 58% coverage: 315:769/779 of query aligns to 2:449/459 of 4il8A
- active site: R16 (= R329), S104 (= S417), H105 (= H418), K114 (= K427), D238 (= D553), D240 (= D555), D242 (= D557), R243 (= R558), A325 (≠ H640), D336 (= D651)
- binding magnesium ion: S104 (= S417), D238 (= D553), D240 (= D555), D242 (= D557)
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
56% identity, 58% coverage: 322:769/779 of query aligns to 2:426/436 of 3rsmA
- active site: C87 (≠ S417), K91 (= K427), D215 (= D553), D217 (= D555), D219 (= D557), R220 (= R558), H302 (= H640), D313 (= D651)
- binding phosphate ion: C87 (≠ S417), D215 (= D553), D217 (= D555), D219 (= D557), R220 (= R558)
- binding zinc ion: D215 (= D553), D217 (= D555), D219 (= D557)
3uw2A X-ray crystal structure of phosphoglucomutase/phosphomannomutase family protein (bth_i1489)from burkholderia thailandensis (see paper)
56% identity, 58% coverage: 318:769/779 of query aligns to 2:448/458 of 3uw2A
- active site: R13 (= R329), S109 (= S417), H110 (= H418), K119 (= K427), D243 (= D553), D245 (= D555), D247 (= D557), R248 (= R558), H330 (= H640)
- binding zinc ion: D243 (= D553), D245 (= D555), D247 (= D557)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
34% identity, 56% coverage: 322:755/779 of query aligns to 4:437/455 of 1wqaA
- active site: R11 (= R329), S101 (= S417), H102 (= H418), K111 (= K427), D243 (= D553), D245 (= D555), D247 (= D557), R248 (= R558), G330 (≠ H640), R340 (≠ D651)
- binding magnesium ion: S101 (= S417), D243 (= D553), D245 (= D555), D247 (= D557)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6nqhA
- active site: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640)
- binding magnesium ion: D237 (= D553), D239 (= D555), D241 (= D557)
- binding 1-O-phosphono-alpha-D-xylopyranose: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D239 (= D555), R242 (= R558), R280 (≠ K596), S301 (≠ T617), G302 (= G618), E320 (= E636), S322 (= S638), H324 (= H640), R414 (= R737), S416 (= S739), N417 (= N740), T418 (= T741), R423 (≠ V746)
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6np8A
- active site: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640)
- binding calcium ion: S97 (= S417), D237 (= D553), D239 (= D555), D241 (= D557)
- binding 6-O-phosphono-alpha-D-mannopyranose: Y9 (= Y326), R280 (≠ K596), G302 (= G618), H303 (= H619), E320 (= E636), S322 (= S638), H324 (= H640), R414 (= R737), S416 (= S739), N417 (= N740), T418 (= T741), R423 (≠ V746)
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6nolA
- active site: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G618), E320 (= E636), S322 (= S638), H324 (= H640), R414 (= R737), S416 (= S739), N417 (= N740), T418 (= T741), R423 (≠ V746)
- binding magnesium ion: S97 (= S417), D237 (= D553), D239 (= D555), D241 (= D557)
6nnpA Xanthomonas citri dephospho-pgm in complex with glucose-6-phosphate (see paper)
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6nnpA
- active site: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640)
- binding 6-O-phosphono-alpha-D-glucopyranose: R280 (≠ K596), G302 (= G618), H303 (= H619), E320 (= E636), H324 (= H640), R414 (= R737), S416 (= S739), N417 (= N740), T418 (= T741), R423 (≠ V746)
- binding magnesium ion: S97 (= S417), D237 (= D553), D239 (= D555), D241 (= D557)
6nn2A Xanthomonas citri pgm apo-phospho (see paper)
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6nn2A
- active site: R12 (= R329), S97 (= S417), H98 (= H418), K107 (= K427), D237 (= D553), D239 (= D555), D241 (= D557), R242 (= R558), H324 (= H640)
- binding calcium ion: S97 (= S417), D237 (= D553), D239 (= D555), D241 (= D557)
6n1eA Crystal structure of x. Citri phosphoglucomutase in complex with 1- methyl-glucose 6-phosphate (see paper)
35% identity, 57% coverage: 323:763/779 of query aligns to 6:440/448 of 6n1eA
Query Sequence
>WP_057687434.1 NCBI__GCF_001431535.1:WP_057687434.1
MIGSKGKGVAVTGRTGPLLAAMLLLLAGLFGWSAVQQWRQANTGTQLEQARDTALQGLQK
TLDGQLLQFGKHLKSARVEQALAAGDGAAAALALRETWTGVEEVQVWPASLETAYADPAA
FGYARLALLEAALVSEEPVARVVRDAGGARLGLAASVPLGSDGLALVYVRQPLMQLTGPL
DAVRAPAEGYLALRQGSYNVLERGDRKLADSGEVLARPLANSSLRLAAGVPSIEPGPLGL
GALAASIVALLLVLIAVLLLVGKSRLPLPRRAAREGTEEQGPTLSESLAQSAAELPTAAA
AEPGAGAALEPPPLAASLAAGIFRAYDIRGVVGEELTPKVAALIGQAIGSEVLAQGLREV
VIGRDGRLSGPELAAGLAEGLRRAGCDVIDIGLAPTPVVYFASHHLRTGSCVAVTGSHNP
PEYNGFKIVIAGQTLSGDAVTALYQRIVEGRLAQASSPGNYQQREVNDDYVRRIADDVQL
ERPLKVVADAGNGVAGALVQPLLEAIGADVIPLYCDVDGNFPNHHPDPSEPANLQDLVQT
VKRFDADLGIAFDGDGDRLGVVTPDGTIIFADRLLMLFAADVLLRNPGAMVIYDVKCTGK
LADFVLRHGGSPMMWKTGHSLIKARMAETDAELAGEMSGHFFFRERWFGFDDGLYAAARL
LEILALREETPQEVLEELPQSISTPEIKVPVADGTPHALVSLVVSAAQSGDNPFVGGRIS
TIDGLRVDFADGWGLVRASNTTPVLVLRFEADTEEALERIKAQFRTQLQPLLGDQDLGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory