Comparing WP_058929074.1 NCBI__GCF_001484605.1:WP_058929074.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
35% identity, 92% coverage: 10:236/248 of query aligns to 6:240/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 91% coverage: 10:234/248 of query aligns to 2:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 86% coverage: 22:234/248 of query aligns to 14:235/235 of 6mhzA
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 86% coverage: 22:234/248 of query aligns to 14:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 86% coverage: 22:234/248 of query aligns to 14:235/238 of 6s8gA
Sites not aligning to the query:
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 86% coverage: 22:234/248 of query aligns to 15:236/241 of 6mbnA
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 84% coverage: 22:230/248 of query aligns to 14:231/233 of 6b8bA
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 85% coverage: 22:233/248 of query aligns to 14:234/234 of 6b89A
Sites not aligning to the query:
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 85% coverage: 22:233/248 of query aligns to 14:234/234 of 4p31A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 85% coverage: 9:218/248 of query aligns to 1:219/241 of 4u00A
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
28% identity, 94% coverage: 10:243/248 of query aligns to 3:247/247 of P55339
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 83% coverage: 13:217/248 of query aligns to 479:695/728 of Q9LVM1
7n5aA Structure of atatm3 in the closed conformation (see paper)
31% identity, 83% coverage: 13:217/248 of query aligns to 352:568/589 of 7n5aA
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
31% identity, 83% coverage: 13:217/248 of query aligns to 353:569/590 of 7n59A
Sites not aligning to the query:
7ehlA Cryo-em structure of human abcb8 transporter in nucleotide binding state (see paper)
32% identity, 85% coverage: 22:233/248 of query aligns to 339:559/563 of 7ehlA
Sites not aligning to the query:
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
28% identity, 98% coverage: 3:244/248 of query aligns to 578:836/842 of Q9DC29
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 84% coverage: 10:217/248 of query aligns to 4:218/285 of 4yerA
Q9NUT2 Mitochondrial potassium channel ATP-binding subunit; ATP-binding cassette sub-family B member 8, mitochondrial; ABCB8; Mitochondrial ATP-binding cassette 1; M-ABC1; Mitochondrial sulfonylurea-receptor; MITOSUR from Homo sapiens (Human) (see 4 papers)
31% identity, 89% coverage: 22:241/248 of query aligns to 486:715/735 of Q9NUT2
Sites not aligning to the query:
7m33C The structure of bacillus subtilis bmrcd in the inward-facing conformation bound to hoechst-33342 and atp (see paper)
29% identity, 83% coverage: 26:230/248 of query aligns to 353:566/573 of 7m33C
Sites not aligning to the query:
8fhkC Heterodimeric abc transporter bmrcd in the occluded conformation bound to atp: bmrcd_oc-atp (see paper)
29% identity, 83% coverage: 26:230/248 of query aligns to 352:565/574 of 8fhkC
Sites not aligning to the query:
>WP_058929074.1 NCBI__GCF_001484605.1:WP_058929074.1
MTPGTAPRPILRIEGLNAHIAGQQVVEDVSFTVPTTGITALLGRNGVGKTSTIKAIIGLI
DRSGVVELDGVRVEKEPTYKIIRSGVGYVPEDREVFSKLTVAENLRLAERDAAPRRQLVE
ELFPDLLARSGQMAGTLSGGQQQMVSLARALLNTNKILLVDEPTKGLAPKIVAEVAETLA
EAAKTVPILLVEQNLQVVRQLAAGAVVLSGGRVVHTGNALDFLNDDGLTQRLLGVSTETA
PHEKGAAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory