Comparing WP_058929169.1 NCBI__GCF_001484605.1:WP_058929169.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7etiA Crystal structure of abhpai-zn-pyruvate-4-hydroxybenzaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etiA
7etfA Crystal structure of abhpai-mn-pyruvate-succinic semialdehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etfA
7eteA Crystal structure of abhpai-mg-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7eteA
7etdA Crystal structure of abhpai-zn-(4s)-kdglu complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etdA
7etcA Crystal structure of abhpai-zn-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etcA
7etbA Crystal structure of abhpai-mn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etbA
7etaA Crystal structure of abhpai-co-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/253 of 7etaA
7ethA Crystal structure of abhpai-zn-pyruvate-propionaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 15:244/251 of 7ethA
7et9A Crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
31% identity, 92% coverage: 9:235/246 of query aligns to 17:246/254 of 7et9A
P23522 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 from Escherichia coli (strain K12) (see paper)
30% identity, 95% coverage: 8:240/246 of query aligns to 19:253/256 of P23522
1dxfA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli in complex with pyruvate (see paper)
30% identity, 95% coverage: 8:240/246 of query aligns to 16:250/253 of 1dxfA
1dxeA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli (see paper)
30% identity, 95% coverage: 8:240/246 of query aligns to 16:250/253 of 1dxeA
8adqA Crystal structure of holo-swhpa-mg (hydroxy ketone aldolase) from sphingomonas wittichii rw1 in complex with hydroxypyruvate and d- glyceraldehyde (see paper)
34% identity, 90% coverage: 10:230/246 of query aligns to 16:238/252 of 8adqA
7o5rA Crystal structure of holo-swhpa-mn (hydroxyketoacid aldolase) from sphingomonas wittichii rw1 (see paper)
34% identity, 90% coverage: 10:230/246 of query aligns to 15:237/251 of 7o5rA
A0A9J9HGY6 Hydroxypyruvate/pyruvate aldolase; HPA/PA aldolase; Hydroxy ketoacid aldolase; SwHKA; EC 4.1.2.- from Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1) (Sphingomonas wittichii) (see paper)
34% identity, 90% coverage: 10:230/246 of query aligns to 15:237/251 of A0A9J9HGY6
2vwtA Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex (see paper)
30% identity, 92% coverage: 8:234/246 of query aligns to 18:247/256 of 2vwtA
P76469 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; 2-dehydro-3-deoxyrhamnonate aldolase; 2-keto-3-deoxy acid sugar aldolase; EC 4.1.2.53 from Escherichia coli (strain K12) (see paper)
30% identity, 92% coverage: 8:234/246 of query aligns to 18:247/267 of P76469
4b5vA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with 4-hydroxyl-2-ketoheptane-1,7-dioate (see paper)
28% identity, 89% coverage: 9:228/246 of query aligns to 15:237/251 of 4b5vA
4b5tA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with ketobutyrate (see paper)
28% identity, 89% coverage: 9:228/246 of query aligns to 15:237/251 of 4b5tA
4b5sA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with pyruvate (see paper)
28% identity, 89% coverage: 9:228/246 of query aligns to 15:237/251 of 4b5sA
>WP_058929169.1 NCBI__GCF_001484605.1:WP_058929169.1
MSDERHTVKIGAWANLGEPRAAVALEESGADWVCLDAQHGHFDDRSVRETLALRQSAKVP
MLVRLLSDDGAGIGRALDSGADGVIVPMVESALQAANVVRASFHPPRGSRSFGPMTGVSY
NTAGGYPKRGPLLAVMIETATGLENLEDIAATTGIDMLFVGPYDLALSLGTDVDTLLADA
APKSPLSRVIDACSAADLIPGAFGGTPIRARRLLDRGFSWVSNCVDTSLMQEGFKVMKDS
SLGERV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory