Comparing WP_058931156.1 NCBI__GCF_001484605.1:WP_058931156.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1NEI7 2,4-didehydro-3-deoxy-L-rhamnonate hydrolase; L-2,4-diketo-3-deoxyrhamnonate hydrolase; L-DKDR hydrolase; SpLRA6; EC 3.7.1.26 from Sphingomonas sp. (strain SKA58) (see paper)
42% identity, 99% coverage: 1:277/280 of query aligns to 1:272/285 of Q1NEI7
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
42% identity, 99% coverage: 2:277/280 of query aligns to 7:277/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
42% identity, 99% coverage: 2:277/280 of query aligns to 7:277/290 of 8gsrA
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
41% identity, 77% coverage: 58:272/280 of query aligns to 77:294/301 of O06724
Sites not aligning to the query:
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 77% coverage: 58:272/280 of query aligns to 77:294/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
41% identity, 77% coverage: 58:272/280 of query aligns to 78:295/303 of 8sutA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
43% identity, 81% coverage: 54:280/280 of query aligns to 52:277/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
41% identity, 79% coverage: 59:280/280 of query aligns to 56:276/277 of 6iymA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
37% identity, 78% coverage: 57:275/280 of query aligns to 48:257/265 of 3r6oA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
39% identity, 84% coverage: 38:272/280 of query aligns to 39:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
39% identity, 84% coverage: 38:272/280 of query aligns to 39:270/280 of 6j5xA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
40% identity, 75% coverage: 62:272/280 of query aligns to 53:241/252 of 3qdfA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 76% coverage: 62:273/280 of query aligns to 53:261/269 of 4dbhA
1gttA Crystal structure of hpce (see paper)
38% identity, 63% coverage: 74:250/280 of query aligns to 225:392/421 of 1gttA
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
38% identity, 73% coverage: 74:277/280 of query aligns to 17:215/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 73% coverage: 74:277/280 of query aligns to 14:212/216 of 6sbiA
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
37% identity, 71% coverage: 74:271/280 of query aligns to 17:209/221 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
37% identity, 71% coverage: 74:271/280 of query aligns to 15:207/218 of 6fogA
Sites not aligning to the query:
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
35% identity, 71% coverage: 72:270/280 of query aligns to 17:211/219 of P76004
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
36% identity, 63% coverage: 74:249/280 of query aligns to 18:196/224 of 3v77A
>WP_058931156.1 NCBI__GCF_001484605.1:WP_058931156.1
MKFAQIGAPGAEQPVLVHGDRHYSLQSITPAINGDFLSNGGPAAAAAALAAGTLPDVSSD
AVRYGAPVVRPSAVVCVGLNYAAHAAESGAEPPEHPVIFLKTPNTVGGPDDAVAIPRGST
KTDWEVELGIIIGKRASYLDSPEAARDHIGGFVVVDDLSERDFQLNVSGGQWSKGKSSPG
FCPTGPYLVTPDEIDAGKLRLRSWVNGEIRQDSSTADMIFDVETIVWNLSQYMVLEPGDL
ICTGTPEGVALSGRFPYLKAGDVVEIEIDGLGRQRHEFIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory