Comparing WP_058932370.1 NCBI__GCF_001484605.1:WP_058932370.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pnzA The structure of the aspartate transcarbamoylase trimer from staphylococcus aureus complexed with pala at 2.27 resolution.
39% identity, 89% coverage: 1:316/356 of query aligns to 1:292/293 of 6pnzA
3r7fA Crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
37% identity, 88% coverage: 1:312/356 of query aligns to 1:285/291 of 3r7fA
3r7dA Crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis (see paper)
37% identity, 88% coverage: 1:312/356 of query aligns to 1:285/291 of 3r7dA
3r7lA Crystal structure of pala-bound aspartate transcarbamoylase from bacillus subtilis (see paper)
37% identity, 88% coverage: 1:312/356 of query aligns to 1:285/290 of 3r7lA
P05654 Aspartate carbamoyltransferase catalytic subunit; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Bacillus subtilis (strain 168) (see paper)
37% identity, 88% coverage: 1:312/356 of query aligns to 1:285/304 of P05654
Sites not aligning to the query:
4bjhB Crystal structure of the aquifex reactor complex formed by dihydroorotase (h180a, h232a) with dihydroorotate and aspartate transcarbamoylase with n-(phosphonacetyl)-l-aspartate (pala) (see paper)
35% identity, 88% coverage: 1:315/356 of query aligns to 1:289/291 of 4bjhB
3d6nB Crystal structure of aquifex dihydroorotase activated by aspartate transcarbamoylase (see paper)
35% identity, 88% coverage: 1:315/356 of query aligns to 1:289/291 of 3d6nB
1ml4A The pala-liganded aspartate transcarbamoylase catalytic subunit from pyrococcus abyssi (see paper)
36% identity, 88% coverage: 4:316/356 of query aligns to 7:304/307 of 1ml4A
4eknB Structure of the catalytic chain of methanococcus jannaschii aspartate transcarbamoylase in a hexagonal crystal form (see paper)
34% identity, 89% coverage: 1:317/356 of query aligns to 1:301/304 of 4eknB
5g1nE Aspartate transcarbamoylase domain of human cad bound to pala (see paper)
34% identity, 88% coverage: 2:316/356 of query aligns to 6:304/307 of 5g1nE
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
34% identity, 88% coverage: 2:316/356 of query aligns to 1924:2222/2225 of P27708
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
35% identity, 88% coverage: 2:316/356 of query aligns to 1924:2222/2225 of P08955
Sites not aligning to the query:
8bplA Aspartate transcarbamoylase mutant (n2045c, r2238c) from chaetomium thermophilum cad-like bound to carbamoyl phosphate (see paper)
33% identity, 88% coverage: 3:317/356 of query aligns to 17:316/316 of 8bplA
5g1pA Aspartate transcarbamoylase domain of human cad bound to carbamoyl phosphate (see paper)
32% identity, 88% coverage: 2:316/356 of query aligns to 3:289/292 of 5g1pA
P49077 Aspartate carbamoyltransferase, chloroplastic; Aspartate transcarbamylase; ATCase; EC 2.1.3.2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 85% coverage: 18:318/356 of query aligns to 101:389/390 of P49077
P20054 Multifunctional protein pyr1-3; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Dictyostelium discoideum (Social amoeba)
33% identity, 88% coverage: 2:316/356 of query aligns to 1923:2221/2225 of P20054
Sites not aligning to the query:
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 89% coverage: 2:319/356 of query aligns to 1911:2213/2214 of P07259
Sites not aligning to the query:
6ys6B Arabidopsis aspartate transcarbamoylase complex with pala (see paper)
35% identity, 85% coverage: 18:318/356 of query aligns to 23:311/312 of 6ys6B
6ypoA Arabidopsis aspartate transcarbamoylase bound to ump (see paper)
35% identity, 85% coverage: 18:318/356 of query aligns to 23:311/312 of 6ypoA
6yvbC Arabidopsis aspartate transcarbamoylase complex with carbamoyl phosphate (see paper)
37% identity, 85% coverage: 18:318/356 of query aligns to 35:323/324 of 6yvbC
>WP_058932370.1 NCBI__GCF_001484605.1:WP_058932370.1
MKHLLSTEDLSLANAIRILDTAEEMAAVGDREVKKLPALRGRTVVNLFFEDSTRTRISFE
AAAKRLSADVINFAAKGSSVSKGESLKDTAQTLAAMGADAVVIRHWASGAPHRLAATDWI
DAAVINAGDGTHEHPTQALLDAFTMRRHWSKLAGSASTGADLKGMRVAIAGDVLHSRVAR
SNVWLLRTLGADVTLVAPPTLLPIGVEHWPCKVSYNMDDTLAQGVDAVMMLRVQGERMNA
SFFPSTREYSRRWGFDDNRLRALDSLGLKDTIIMHPGPMNRGLEISSAAADSPRSTVLAQ
VRNGVSVRMATLYLLLSGDTREPAASAGAATNTVRTNTAHTNAARSNAAHSTKESN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory