SitesBLAST
Comparing WP_058932805.1 NCBI__GCF_001484605.1:WP_058932805.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
38% identity, 90% coverage: 24:311/320 of query aligns to 17:304/304 of 1wwkA
- active site: S96 (= S105), R230 (= R237), D254 (= D261), E259 (= E266), H278 (= H285)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A109), G146 (= G153), F147 (≠ L154), G148 (= G155), R149 (≠ K156), I150 (= I157), Y168 (≠ W175), D169 (≠ S176), P170 (≠ Q177), V201 (≠ L208), P202 (≠ R209), T207 (≠ S214), T228 (= T235), S229 (= S236), D254 (= D261), H278 (= H285), G280 (= G287)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 71% coverage: 67:293/320 of query aligns to 61:296/334 of 5aovA
- active site: L100 (≠ P106), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H285)
- binding glyoxylic acid: Y74 (≠ T80), A75 (≠ G81), V76 (≠ M82), G77 (≠ A83), R241 (= R237), H288 (= H285)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ M82), T104 (≠ A109), F158 (≠ L154), G159 (= G155), R160 (≠ K156), I161 (= I157), S180 (= S176), R181 (≠ Q177), A211 (≠ H207), V212 (≠ L208), P213 (≠ R209), T218 (≠ S214), I239 (≠ T235), A240 (≠ S236), R241 (= R237), H288 (= H285), G290 (= G287)
Sites not aligning to the query:
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 31:285/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ S105), A100 (= A109), R149 (≠ K156), I150 (= I157), Y168 (≠ W175), D169 (≠ S176), P170 (≠ Q177), I171 (≠ N178), H200 (= H207), T201 (≠ L208), P202 (≠ R209), T207 (≠ S214), C228 (≠ T235), A229 (≠ S236), R230 (= R237), H277 (= H285), G279 (= G287)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 31:285/297 of 6rj3A
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 33:287/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ M82), A102 (= A109), G148 (= G153), R151 (≠ K156), I152 (= I157), Y170 (≠ W175), D171 (≠ S176), P172 (≠ Q177), I173 (≠ N178), H202 (= H207), T203 (≠ L208), P204 (≠ R209), T209 (≠ S214), C230 (≠ T235), A231 (≠ S236), R232 (= R237), H279 (= H285), G281 (= G287)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 29:283/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G155), I148 (= I157), Y166 (≠ W175), D167 (≠ S176), P168 (≠ Q177), I169 (≠ N178), I170 (≠ L179), H198 (= H207), T199 (≠ L208), L208 (≠ I217), R228 (= R237)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 32:286/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V152), G147 (= G153), L148 (= L154), G149 (= G155), R150 (≠ K156), I151 (= I157), G152 (= G158), D170 (≠ S176), H201 (= H207), T202 (≠ L208), P203 (≠ R209)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 32:286/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 32:286/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 32:286/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 79% coverage: 40:293/320 of query aligns to 33:287/305 of 6plfA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 79% coverage: 40:293/320 of query aligns to 37:291/533 of O43175
- T78 (≠ M82) binding
- R135 (≠ T138) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 156:157) binding
- D175 (≠ S176) binding
- T207 (≠ L208) binding
- CAR 234:236 (≠ TSR 235:237) binding
- D260 (= D261) binding
- V261 (= V262) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HLGY 285:288) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
2eklA Structure of st1218 protein from sulfolobus tokodaii
34% identity, 81% coverage: 37:296/320 of query aligns to 32:293/312 of 2eklA
- active site: S100 (≠ P106), R232 (= R237), D256 (= D261), E261 (= E266), H282 (= H285)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ M82), S100 (≠ P106), G148 (= G153), G150 (= G155), R151 (≠ K156), I152 (= I157), Y170 (≠ W175), D171 (≠ S176), I172 (≠ Q177), L173 (≠ N178), H202 (= H207), V203 (≠ L208), T204 (≠ R209), I212 (= I217), T230 (= T235), S231 (= S236), D256 (= D261), G284 (= G287)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
37% identity, 67% coverage: 80:293/320 of query aligns to 64:277/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K156), Y160 (≠ W175), D161 (≠ S176), P162 (≠ Q177), I164 (≠ L179), L179 (≠ K194), T193 (≠ L208), P194 (≠ R209), S198 (≠ R213), L202 (≠ I217)
6v89A Human ctbp1 (28-375) in complex with amp (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 32:316/332 of 6v89A
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 32:316/328 of 4u6sA
- active site: S99 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H285)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ A109), G156 (= G153), G158 (= G155), R159 (≠ K156), V160 (≠ I157), Y178 (≠ W175), D179 (≠ S176), P180 (≠ Q177), Y181 (≠ N178), H211 (= H207), C212 (≠ L208), G213 (≠ R209), N218 (≠ S214), T239 (= T235), A240 (≠ S236), R241 (= R237), H290 (= H285), W293 (≠ Y288)
- binding 3-phenylpyruvic acid: Y51 (≠ R58), H52 (≠ E59), I73 (≠ T80), G74 (= G81), S75 (≠ M82), G76 (≠ A83), R241 (= R237), W293 (≠ Y288), M302 (≠ F297)
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 32:316/328 of 4u6qA
- active site: S99 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H285)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: Y51 (≠ R58), I73 (≠ T80), G74 (= G81), S75 (≠ M82), G76 (≠ A83), R241 (= R237), H290 (= H285), W293 (≠ Y288), M302 (≠ F297)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (≠ M82), T103 (≠ A109), G156 (= G153), R159 (≠ K156), V160 (≠ I157), Y178 (≠ W175), D179 (≠ S176), P180 (≠ Q177), Y181 (≠ N178), H211 (= H207), C212 (≠ L208), G213 (≠ R209), N218 (≠ S214), T239 (= T235), A240 (≠ S236), R241 (= R237), H290 (= H285), W293 (≠ Y288)
6cdfA Human ctbp1 (28-378) (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 33:317/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ A109), G157 (= G153), R160 (≠ K156), V161 (≠ I157), Y179 (≠ W175), D180 (≠ S176), P181 (≠ Q177), Y182 (≠ N178), H212 (= H207), C213 (≠ L208), N219 (≠ S214), T240 (= T235), A241 (≠ S236), R242 (= R237), H291 (= H285), W294 (≠ Y288)
4lceA Ctbp1 in complex with substrate mtob (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 31:315/327 of 4lceA
- active site: S98 (= S105), R240 (= R237), D264 (= D261), E269 (= E266), H289 (= H285)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ T79), G73 (= G81), S74 (≠ M82), G75 (≠ A83), R240 (= R237), H289 (= H285), W292 (≠ Y288)
- binding nicotinamide-adenine-dinucleotide: S74 (≠ M82), T102 (≠ A109), G155 (= G153), G157 (= G155), R158 (≠ K156), V159 (≠ I157), Y177 (≠ W175), D178 (≠ S176), P179 (≠ Q177), Y180 (≠ N178), H210 (= H207), C211 (≠ L208), N214 (≠ S211), N217 (≠ S214), T238 (= T235), A239 (≠ S236), R240 (= R237), W292 (≠ Y288)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
32% identity, 85% coverage: 39:311/320 of query aligns to 32:316/331 of 1hl3A
- active site: S99 (= S105), R241 (= R237), D265 (= D261), E270 (= E266), H290 (= H285)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ A109), G158 (= G155), R159 (≠ K156), V160 (≠ I157), D179 (≠ S176), Y181 (≠ N178), H211 (= H207), C212 (≠ L208), G213 (≠ R209), N218 (≠ S214), T239 (= T235), A240 (≠ S236), R241 (= R237), D265 (= D261), H290 (= H285)
- binding : E36 (≠ A43), H38 (≠ A45), E39 (≠ A46)
Sites not aligning to the query:
Query Sequence
>WP_058932805.1 NCBI__GCF_001484605.1:WP_058932805.1
MQQRLAILDDYQDVAHGFADWAALEQAGVTASVFREPFQSEDALAAALANYQIVIAMRER
TPFPRTVLERLPGLKLLVTTGMANAAIDVAAATELGITVCGTPGSPTAAPELTWALLLAI
ARNLPSEENSLRAGTWQTSVGMELSGKTLGVVGLGKIGRRIAAYGQAFGMEVLAWSQNLT
DEAAAEAGVQKVSKEDLFENSDVVSLHLRLSPRSEDIVGEQELRLLGPEGILVNTSRGPL
VNQDALVRALNEGWIRGAALDVFDQEPLPAGHPLLSAPNTVLSPHLGYVTAESYRQFYGG
AFEDVKAWLEGTPVRVITAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory