Comparing WP_058932847.1 NCBI__GCF_001484605.1:WP_058932847.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
26% identity, 89% coverage: 35:305/305 of query aligns to 12:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
28% identity, 75% coverage: 76:305/305 of query aligns to 48:296/296 of P68183
>WP_058932847.1 NCBI__GCF_001484605.1:WP_058932847.1
MPTTTAPSPLSTKVSGGNGARRRRYHAEGLEAGKRSTRTLLWILLAAAMILYGFPFLYLL
FTSFKTPIDTIAVPPTILPREWTLENYTNALGRSGVLASFINSAQTAIISTVLSLVLAVP
AAYGITRYKTPSGRVFIMAALVTRMVPPVAIGIPLASMMSAAGLADTPIALSIAHTTISL
PLSIWLMSSFFEAVPQDLEEAATVDGCSRLGALWRVVIPVVSGGIAVTAIFAFLASWNEF
LFALLMTAVRSQTTPVVIANFQTQFGLDWGSMTALAAVYSIPVILLTLLLQRKIVAGMTL
GAVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory