Comparing WP_059150649.1 NCBI__GCF_001046635.1:WP_059150649.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5A Lbcats
45% identity, 97% coverage: 4:254/258 of query aligns to 8:256/261 of 5ey5A
8b08A Tryptophan synthase - cryo-trapping by the spitrobot crystal plunger after 30 sec (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 2:245/269 of 8b08A
1k3uA Crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]aspartic acid (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:244/268 of 1k3uA
1tjpA Crystal structure of wild-type tryptophan synthase complexed with 1- [(2-hydroxylphenyl)amino]3-glycerolphosphate (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:244/267 of 1tjpA
2clkA Tryptophan synthase in complex with d-glyceraldehyde 3- phosphate (g3p) (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:244/267 of 2clkA
7jllA The internal aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with inhibitor 2- ({[4-(trifluoromethoxy)phenyl]sulfonyl}amino)ethyl dihydrogen phosphate (f9f) at the alpha-site, cesium ion at the metal coordination site and l-tryptophan at the enzyme beta-site
35% identity, 90% coverage: 3:235/258 of query aligns to 2:243/267 of 7jllA
6xncA Salmonella typhimurium tryptophan synthase complexed with l-tryptophan and d-glycerol-3-phosphate (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:243/267 of 6xncA
3cepA Structure of a tryptophan synthase quinonoid intermediate (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:243/266 of 3cepA
2trsA Crystal structures of mutant (betak87t) tryptophan synthase alpha2 beta2 complex with ligands bound to the active sites of the alpha and beta subunits reveal ligand-induced conformational changes (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:238/262 of 2trsA
1cx9A Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-aminophenylthio)- butylphosphonic acid (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:241/264 of 1cx9A
1cw2A Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylsulfinyl)- butylphosphonic acid (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:241/264 of 1cw2A
1c9dA Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxy-4- fluorophenylthio)-butylphosphonic acid (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:241/264 of 1c9dA
1c29A Crystal structure of the complex of bacterial tryptophan synthase with the transition state analogue inhibitor 4-(2-hydroxyphenylthio)-1- butenylphosphonic acid (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:241/264 of 1c29A
1k7eA Crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]glycine acid (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:237/261 of 1k7eA
2clhA Tryptophan synthase in complex with (naphthalene-2'-sulfonyl)-2-amino- 1-ethylphosphate (f19) (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:235/258 of 2clhA
2cliA Tryptophan synthase in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9) (see paper)
35% identity, 91% coverage: 1:235/258 of query aligns to 1:234/258 of 2cliA
1a50A Crystal structure of wild-type tryptophan synthase complexed with 5- fluoroindole propanol phosphate (see paper)
35% identity, 90% coverage: 3:235/258 of query aligns to 2:237/260 of 1a50A
6xinA The crystal structure of tryptophan synthase from salmonella enterica serovar typhimurium in complex with (2s)-3-amino-3-imino-2- phenyldiazenylpropanamide at the enzyme alpha-site.
34% identity, 91% coverage: 1:235/258 of query aligns to 1:234/258 of 6xinA
1k7fA Crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]valine acid (see paper)
34% identity, 91% coverage: 1:235/258 of query aligns to 1:230/253 of 1k7fA
7jqwA The external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with cesium ion at the metal coordination site. The single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
33% identity, 91% coverage: 1:235/258 of query aligns to 1:229/253 of 7jqwA
>WP_059150649.1 NCBI__GCF_001046635.1:WP_059150649.1
MTRFETAFAKGPALVCFITGGDGDTASNLDALVAGGADVIELGMPFTDPMADGMAIQEAN
LRSFAAGTKTADIFALATGFRARHPNVPLVLMGYANPMTIRGSEWFADECAKAGVDGVIC
VDIPPEEDAELGPALRAKGVSLIRLATPTTDTARLPAVLEGSSGFLYYVSVAGITGQQQA
AQSSIDEAVARLKAASTIPVAVGFGVRTPEQAAAIAKVADGVVVGSALVDLVKQHGRDAP
GPLQALTSALAQAVHSAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory