Comparing WP_059151689.1 NCBI__GCF_001046635.1:WP_059151689.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 83% coverage: 74:576/608 of query aligns to 51:550/575 of P9WKJ5
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
30% identity, 83% coverage: 74:576/608 of query aligns to 38:537/562 of 6ovtA
9jpiA The complex structure of dhad with aspterric acid (aa). (see paper)
31% identity, 71% coverage: 120:552/608 of query aligns to 94:517/570 of 9jpiA
Sites not aligning to the query:
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 71% coverage: 120:552/608 of query aligns to 132:555/608 of Q9LIR4
Sites not aligning to the query:
8hs0A The mutant structure of dhad v178w (see paper)
31% identity, 71% coverage: 120:552/608 of query aligns to 94:517/570 of 8hs0A
Sites not aligning to the query:
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
28% identity, 85% coverage: 75:591/608 of query aligns to 44:556/583 of Q1JUQ1
9evvD His579leu variant of l-arabinonate dehydratase co-crystallized with 2- oxobutyrate (see paper)
29% identity, 79% coverage: 75:552/608 of query aligns to 43:508/575 of 9evvD
9evvA His579leu variant of l-arabinonate dehydratase co-crystallized with 2- oxobutyrate (see paper)
29% identity, 79% coverage: 75:552/608 of query aligns to 43:508/575 of 9evvA
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
29% identity, 79% coverage: 75:552/608 of query aligns to 47:512/579 of B5ZZ34
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
29% identity, 83% coverage: 75:577/608 of query aligns to 39:530/569 of 8epzA
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg (see paper)
29% identity, 83% coverage: 75:577/608 of query aligns to 38:529/568 of 8ej0A
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
28% identity, 79% coverage: 75:552/608 of query aligns to 44:509/576 of 5j85A
8imuA Dihydroxyacid dehydratase (dhad) mutant-v497f (see paper)
30% identity, 71% coverage: 120:552/608 of query aligns to 91:470/523 of 8imuA
Sites not aligning to the query:
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
28% identity, 70% coverage: 145:571/608 of query aligns to 101:538/587 of 7m3kA
Sites not aligning to the query:
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
29% identity, 75% coverage: 152:606/608 of query aligns to 117:574/589 of 5oynA
Sites not aligning to the query:
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) (Caulobacter crescentus) (see 2 papers)
29% identity, 75% coverage: 152:606/608 of query aligns to 123:580/595 of Q9A9Z2
Sites not aligning to the query:
>WP_059151689.1 NCBI__GCF_001046635.1:WP_059151689.1
MSNLNPAGLNPVVERVTQRVIERSRPSRQRYLDMVEREADNHSDRSFLSCSNLAHGFAAS
GEDKATISAGKSINLGIITAYNDMLSAHQPYGRYPDQMKLFAREVGATAQVAGGVPAMCD
GVTQGFDGMELSLFSRDTIALSTAIGLSHAMFDGTALLGICDKIVPGLFIGAMRFGHLPA
IFVPAGPMPSGISNKEKQKTRQLYAEGKVGREELLASESASYHSAGTCTFYGTANSNQMM
MELMGLHVPASAFVQPNTPLRQALTREATHRLAAMTRKGEDYRPMAKVVDEKAIINAMAG
LLATGGSTNHAIHLPAMARAGGILIDWEDFDELSSVVPLITRVYPNGSGDVNHFQAAGGI
GWVIRELLGAGLAHGDVLTVATGGMAAYASEPVMRDDKLSWIPIPETTDDTMVRPVSNPF
LPDGGMRLVQGNLGRGTFKTSAVDEQRWTIEAPCRVFDTQEGVSQAFKAGELDRDVIVVV
RFQGPRANGMPELHKLTPPLGVLQDKGFKVALVTDGRMSGASGKVPAAIHVTPEALGGGP
LAYLQDGDIVRLCAEDGTLSTTADLSAREPAPSPPPAVGMGRELFAMFRMNAGGAEQGGS
SMLELAGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory