SitesBLAST
Comparing WP_059152208.1 NCBI__GCF_001046635.1:WP_059152208.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yeiC Mechanistic insight into the regulation of pseudomonas aeruginosa aspartate kinase (see paper)
54% identity, 99% coverage: 2:417/419 of query aligns to 1:397/397 of 5yeiC
- binding lysine: M342 (= M362), H345 (= H365), A346 (= A366), G347 (= G367), V348 (= V368), A349 (= A369), S350 (= S370)
- binding threonine: T265 (≠ R284), P266 (= P285), A269 (≠ V288), Q288 (= Q307), N362 (= N382), I363 (= I383)
P26512 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534) (see 2 papers)
44% identity, 99% coverage: 1:415/419 of query aligns to 1:407/421 of P26512
- G277 (= G286) mutation to A: Change in the inhibitory profile upon addition of threonine.
- A279 (≠ V288) mutation to V: Absence of inhibition upon addition of threonine and lysine or lysine alone.
- Q298 (= Q307) mutation to A: Change in the inhibitory profile and absence of dimerization upon addition of threonine.
- S301 (≠ A310) mutation to F: Absence of inhibition upon addition of threonine and lysine or lysine alone.; mutation to Y: Feedback-resistant and enhanced expression of the asd gene.
- V360 (= V368) mutation to A: Change in the inhibitory profile and shows an different oligomer state upon addition of threonine.
- T361 (≠ A369) mutation to A: Change in the inhibitory profile and absence of dimerization upon addition of threonine.
- E363 (≠ T371) mutation to A: Change in the inhibitory profile and absence of dimerization upon addition of threonine.
- F364 (≠ M372) mutation to A: Change in the inhibitory profile and shows an different oligomer state upon addition of threonine.
P41398 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Corynebacterium flavescens (see paper)
43% identity, 99% coverage: 1:415/419 of query aligns to 1:407/421 of P41398
- D345 (≠ A353) mutation to G: Decreased sensitivity of AK activity to concerted feedback inhibition by lysine and threonine.
3aawC Crystal structure of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine (see paper)
43% identity, 99% coverage: 1:415/419 of query aligns to 1:390/392 of 3aawC
- binding lysine: K7 (= K7), S41 (= S41), G136 (= G152), S137 (= S153), D138 (= D154), M337 (= M362), H340 (= H365), T344 (≠ A369), S364 (= S389)
- binding threonine: K258 (≠ R284), G260 (= G286), E261 (≠ A287), A262 (≠ V288), Q281 (= Q307), N357 (= N382), I358 (= I383)
P61489 Aspartokinase; Aspartate kinase; AK; ASK; Threonine-sensitive AK; ThrA; EC 2.7.2.4 from Thermus thermophilus (see paper)
42% identity, 100% coverage: 1:418/419 of query aligns to 1:405/405 of P61489
- K7 (= K7) mutation to A: Loss of aspartokinase activity.; mutation to M: Loss of aspartokinase activity.
- G9 (= G9) mutation to M: Loss of aspartokinase activity.
- G10 (= G10) mutation to A: Significant decrease in the catalytic efficiency.
- S41 (= S41) mutation to A: Significant decrease in the catalytic efficiency. Requires higher concentration of magnesium ion than wild-type.
- A42 (= A42) mutation to S: Loss of aspartokinase activity.
- T47 (= T47) mutation to A: Significant decrease in the affinity for aspartic acid. Requires higher concentration of magnesium ion than wild-type.
- E74 (= E74) mutation to A: Loss of aspartokinase activity.; mutation to Q: Loss of aspartokinase activity.
- G135 (= G135) mutation to A: Very low catalytic efficiency.; mutation to S: Loss of aspartokinase activity.
- R150 (= R150) mutation to A: Significant decrease in the catalytic efficiency.
- D154 (= D154) mutation to A: Significant decrease in the catalytic efficiency. Requires higher concentration of magnesium ion than wild-type.; mutation to N: Significant decrease in the catalytic efficiency. Requires higher concentration of magnesium ion than wild-type.
- D174 (= D174) mutation to A: Significant decrease in the catalytic efficiency.
- D182 (= D182) mutation to A: Significant decrease in the catalytic efficiency.Requires higher concentration of magnesium ion than wild-type.
3l76A Crystal structure of aspartate kinase from synechocystis (see paper)
42% identity, 99% coverage: 2:415/419 of query aligns to 1:406/585 of 3l76A
- binding lysine: D286 (≠ N301), I287 (≠ V302), D288 (= D303), M353 (= M362), R356 (≠ H365), I359 (≠ V368), S380 (= S389), E381 (= E390)
- binding threonine: R269 (= R284), V272 (≠ A287), A273 (≠ V288), Q292 (= Q307), N373 (= N382), I374 (= I383)
Sites not aligning to the query:
- binding lysine: 457, 458, 459, 522, 525, 528, 548, 549, 553
- binding threonine: 440, 443, 463, 542, 543
3ab4A Crystal structure of feedback inhibition resistant mutant of aspartate kinase from corynebacterium glutamicum in complex with lysine and threonine (see paper)
40% identity, 99% coverage: 2:415/419 of query aligns to 1:369/370 of 3ab4A
- binding lysine: M316 (= M362), H319 (= H365), P320 (≠ A366), V322 (= V368), T323 (≠ A369), S343 (= S389), E344 (= E390)
- binding threonine: K239 (≠ R284), G241 (= G286), E242 (≠ A287), A243 (≠ V288), Q262 (= Q307), N336 (= N382), I337 (= I383)
2hmfA Structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate (see paper)
33% identity, 98% coverage: 5:413/419 of query aligns to 3:461/464 of 2hmfA
- binding adenosine-5'-diphosphate: G7 (= G9), T229 (= T173), D230 (= D174), V231 (= V175), Y235 (= Y179), T237 (= T181), D238 (= D182), P239 (= P183), R240 (= R184), K265 (= K209), V266 (= V210)
- binding aspartic acid: S39 (= S41), T45 (= T47), F192 (= F136), R206 (= R150), G207 (= G151), S209 (= S153)
3c1mC Cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate (see paper)
33% identity, 98% coverage: 5:413/419 of query aligns to 3:465/468 of 3c1mC
- binding phosphoaminophosphonic acid-adenylate ester: K5 (= K7), G7 (= G9), G8 (= G10), S39 (= S41), T229 (= T173), D230 (= D174), Y235 (= Y179), D238 (= D182), P239 (= P183), R240 (= R184), K265 (= K209), V266 (= V210)
- binding aspartic acid: T45 (= T47), E129 (= E74), F192 (= F136), R206 (= R150), G207 (= G151), S209 (= S153)
3c1nA Crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine (see paper)
32% identity, 98% coverage: 5:413/419 of query aligns to 3:456/458 of 3c1nA
- binding threonine: G7 (= G9), G8 (= G10), T9 (= T11), S10 (= S12), W227 (≠ Y172), T228 (= T173), D229 (= D174), A406 (≠ H365), I409 (≠ V368), A410 (= A369), N423 (= N382), I424 (= I383), Q429 (≠ I386), E433 (= E390)
2re1A Crystal structure of aspartokinase alpha and beta subunits
55% identity, 36% coverage: 264:415/419 of query aligns to 2:148/148 of 2re1A
4go7X The regulatory subunit of aspartate kinase in complex with threonine from mycobacterium tuberculosis (see paper)
45% identity, 38% coverage: 259:417/419 of query aligns to 4:161/165 of 4go7X
2cdqA Crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s- adenosylmethionine (see paper)
28% identity, 83% coverage: 67:413/419 of query aligns to 117:458/470 of 2cdqA
- binding lysine: E124 (= E74), M327 (≠ V281), Q330 (≠ R284), F333 (≠ A287), L334 (≠ V288), S347 (≠ N301), V348 (= V302), D349 (= D303)
- binding s-adenosylmethionine: G345 (≠ N299), I346 (= I300), S347 (≠ N301), W368 (≠ A328), S369 (≠ R329), R370 (≠ A330), L372 (≠ A332), E376 (= E336)
Sites not aligning to the query:
O81852 Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic; AK-HD 2; AK-HSDH 2; Beta-aspartyl phosphate homoserine 2; EC 2.7.2.4; EC 1.1.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 70% coverage: 124:415/419 of query aligns to 265:553/916 of O81852
- I441 (= I305) mutation to A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- Q443 (= Q307) mutation to A: Loss of threonine sensitivity for the aspartokinase activity and decreased inhibition of homoserine dehydrogenase activity by threonine.
- I522 (= I386) mutation to A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
- Q524 (vs. gap) mutation to A: No effect on the inhibition of aspartokinase activity by threonine, but decreased inhibition of homoserine dehydrogenase activity by threonine.
3tviE Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
26% identity, 98% coverage: 4:413/419 of query aligns to 4:436/439 of 3tviE
P10869 Aspartokinase; Aspartate kinase; EC 2.7.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 3 papers)
26% identity, 82% coverage: 67:410/419 of query aligns to 140:497/527 of P10869
- E254 (≠ D174) mutation to A: Reduces kcat.
- E279 (= E199) mutation to A: Reduces kcat and affects inhibition by threonine.
- H292 (≠ Q212) mutation to A: Reduces kcat.
- A406 (≠ T319) mutation to T: Decreases enzyme stability.
- R419 (≠ A332) mutation to A: Reduces kcat.
- G452 (= G367) mutation to D: Disrupts threonine binding.
- H497 (= H410) mutation to A: Reduces kcat.
Sites not aligning to the query:
- 18 mutation K->R,A,Q: Reduces kcat.
- 25 G→D: Decreases affinity for aspartate and ATP.
- 26 K→I: Decreases affinity for aspartate and ATP.
P08660 Lysine-sensitive aspartokinase 3; Aspartate kinase III; AKIII; Lysine-sensitive aspartokinase III; EC 2.7.2.4 from Escherichia coli (strain K12) (see paper)
27% identity, 97% coverage: 4:411/419 of query aligns to 5:445/449 of P08660
- K8 (= K7) mutation to R: Reduces activity about 98%. Increases KM for aspartate about 40-fold, enzyme is less sensitive to lysine inhibition.
- E119 (= E74) mutation to D: Increases KM for aspartate about 3000-fold.
- R198 (= R150) mutation to K: Increases KM for aspartate about 200-fold.
- D202 (= D154) mutation to E: Reduces activity about 98%. Increases KM for aspartate about 40-fold, enzyme is less sensitive to lysine inhibition.
2j0xA Crystal structure of e. Coli aspartokinase iii in complex with lysine and aspartate (t-state) (see paper)
27% identity, 97% coverage: 4:411/419 of query aligns to 3:443/447 of 2j0xA
- binding aspartic acid: F182 (= F136), G197 (= G151), G198 (= G152), S199 (= S153), D200 (= D154)
- binding lysine: M316 (vs. gap), S319 (≠ R284), F322 (≠ A287), L323 (≠ V288), S336 (≠ N301), V337 (= V302), D338 (= D303), S343 (≠ N308), E344 (= E315)
2j0wA Crystal structure of e. Coli aspartokinase iii in complex with aspartate and adp (r-state) (see paper)
27% identity, 97% coverage: 4:411/419 of query aligns to 3:443/447 of 2j0wA
- binding adenosine-5'-diphosphate: T219 (= T173), D220 (= D174), I224 (≠ V178), Y225 (= Y179), D228 (= D182), R230 (= R184), K255 (= K209), V256 (= V210)
- binding aspartic acid: S37 (= S41), T43 (= T47), E117 (= E74), F182 (= F136), R196 (= R150), G197 (= G151), S199 (= S153)
3tviA Crystal structure of clostridium acetobutylicum aspartate kinase (caak): an important allosteric enzyme for industrial amino acids production (see paper)
25% identity, 98% coverage: 4:414/419 of query aligns to 2:429/429 of 3tviA
Query Sequence
>WP_059152208.1 NCBI__GCF_001046635.1:WP_059152208.1
MARIVMKFGGTSMAGSERIRRVAGIVKRQQEAGHEVAVVVSAMSGETDRLVNFCREANAL
YDPAEYDVVVASGEQVTSGLLALTLQAIGCKARSWQGWQVPIKTDDAHAKARIEEIDADA
LIASMAAGEIAVIPGFQGVSPEGRVTTLGRGGSDTSAVAVAAAVKADRCDIYTDVDGVYT
TDPRIVAKARKLPLVTYEEMLELASVGSKVLQTRSVSLAMKEKVRVQVLSSFIDETAPAA
DTIPGTLIVSDEELEGSDMERQLITGIAADKNEAKVTLTRVPDRPGAVASIFAPLAESNI
NVDMIIQNVAKDKGETDVTFTVPQSDLARAQAMLEERKDSIGYYRLIADGNVAKISVVGV
GMRSHAGVASTMFKTLADRGINIIAISTSEIKVSVLIDTDETELAVRVLHTAYGLDAAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory