Comparing WP_061534454.1 NCBI__GCF_001584165.1:WP_061534454.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
62% identity, 88% coverage: 32:267/267 of query aligns to 2:241/241 of 4qhqA
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
54% identity, 88% coverage: 32:266/267 of query aligns to 2:235/235 of 3tqwA
4yahX Crystal structure of the methionine binding protein, metq (see paper)
52% identity, 88% coverage: 32:267/267 of query aligns to 5:243/245 of 4yahX
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
46% identity, 89% coverage: 30:267/267 of query aligns to 32:272/272 of P04846
Sites not aligning to the query:
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
51% identity, 82% coverage: 32:251/267 of query aligns to 8:228/237 of 3k2dA
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
42% identity, 88% coverage: 30:265/267 of query aligns to 6:245/247 of 4ib2A
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
36% identity, 90% coverage: 28:266/267 of query aligns to 1:240/240 of 1xs5A
3gxaC Crystal structure of gna1946 (see paper)
41% identity, 89% coverage: 30:266/267 of query aligns to 1:237/244 of 3gxaC
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
41% identity, 88% coverage: 32:266/267 of query aligns to 2:236/240 of 6dzxA
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
43% identity, 82% coverage: 46:265/267 of query aligns to 15:239/255 of 1p99A
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
38% identity, 90% coverage: 29:267/267 of query aligns to 3:240/240 of 4oteB
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
38% identity, 90% coverage: 29:267/267 of query aligns to 1:242/242 of 4ntlA
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
34% identity, 88% coverage: 32:267/267 of query aligns to 13:260/260 of 6jf1A
Sites not aligning to the query:
>WP_061534454.1 NCBI__GCF_001584165.1:WP_061534454.1
MNRRQLVNLFAGLSVIASLGAAAPAFTQDKPIKIGATGGPHAQILEVVKKVAAKDGLNIQ
IVEFSDYVQPNAALAAGDLDANSYQHLPYLEAQIKDRGYKLVNVGYTITFPMGVYSKKVK
SLKDLKNGARIGVPNDPTNGGRALLLLQAQGLLKLKADAGLKATPLDITDNPKKLKIVEI
DAAQLPRSLDDLDAAAINGNYAESAGLDPTKDGIAIEGAKGPYANVIAVRIADKDKPWVA
KLIKAYHSPEVKQYVVTQFKSSVIPAW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory