Comparing WP_061937245.1 NCBI__GCF_001584185.1:WP_061937245.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
33% identity, 93% coverage: 7:282/296 of query aligns to 2:282/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
33% identity, 93% coverage: 7:282/296 of query aligns to 2:282/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
33% identity, 93% coverage: 7:282/296 of query aligns to 2:282/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
33% identity, 93% coverage: 7:282/296 of query aligns to 2:282/297 of 4gn7A
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
36% identity, 94% coverage: 17:293/296 of query aligns to 13:285/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
36% identity, 94% coverage: 17:293/296 of query aligns to 13:285/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) (Caulobacter crescentus) (see paper)
36% identity, 94% coverage: 17:293/296 of query aligns to 13:285/289 of Q9A9Z1
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
31% identity, 93% coverage: 7:282/296 of query aligns to 4:284/299 of Q15493
4gncA Human smp30/gnl-1,5-ag complex (see paper)
31% identity, 93% coverage: 7:282/296 of query aligns to 3:283/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
31% identity, 93% coverage: 7:282/296 of query aligns to 2:282/297 of 3g4hA
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
35% identity, 89% coverage: 19:282/296 of query aligns to 15:292/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
35% identity, 89% coverage: 19:282/296 of query aligns to 15:292/307 of 5d9bA
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
32% identity, 63% coverage: 88:272/296 of query aligns to 99:286/290 of 3e5zA
Sites not aligning to the query:
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
27% identity, 85% coverage: 9:259/296 of query aligns to 1:282/306 of 7rizA
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
35% identity, 53% coverage: 103:259/296 of query aligns to 128:288/299 of 3dr2A
Sites not aligning to the query:
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
26% identity, 85% coverage: 9:259/296 of query aligns to 3:269/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
26% identity, 85% coverage: 9:259/296 of query aligns to 3:269/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
26% identity, 85% coverage: 9:259/296 of query aligns to 3:269/293 of 8djfA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
30% identity, 46% coverage: 124:259/296 of query aligns to 130:269/293 of 7risA
Sites not aligning to the query:
>WP_061937245.1 NCBI__GCF_001584185.1:WP_061937245.1
MIQQFDFPVRMLRAEGAIVGESPVWSQREQVLYWVDILKPALHRFDPASGQQRSWTAPAA
IGSISLARNGKIVTALRSGFHWFDPADASWTLIAHPEPHISHNRLNDGKTGPDGAFWAGT
MDDRADKQPCASLYRLAPDGSISAHGNGLVVSNGLAWSPDGRTMYHSDSRRAVIYRYDFD
AASGALGPRQVFVQMQPEWGRPDGGAIDAEGNYWGCGITAGRINKFSPQGQLLGYLPLPV
SRPTMCAFGGADLKTLYITSLTENMSAEELAREPLAGALFAVDMPVAGTPVAEFGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory