SitesBLAST
Comparing WP_061942678.1 NCBI__GCF_001584185.1:WP_061942678.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
39% identity, 96% coverage: 1:323/335 of query aligns to 1:323/337 of Q3L181
- D52 (= D51) mutation to A: 99% loss of activity.
- Y57 (= Y56) mutation to A: 99% loss of activity.
- K84 (= K82) mutation to A: Total loss of activity.
- H126 (≠ A125) mutation to A: 98% loss of activity.
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
37% identity, 93% coverage: 1:310/335 of query aligns to 1:278/287 of 3v0sA
- active site: D45 (= D51), Y50 (= Y56), G87 (≠ W93), H119 (≠ A125)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (≠ G204), P199 (≠ V205), I200 (≠ L206), G201 (≠ S207), L204 (= L210), P246 (≠ V278), G247 (= G279), T248 (≠ A280), T249 (≠ R281), N253 (≠ R285), N256 (≠ E288), N257 (≠ S289)
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 91% coverage: 1:306/335 of query aligns to 1:306/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
31% identity, 93% coverage: 2:312/335 of query aligns to 1:311/311 of 1pz0A
- active site: D52 (= D51), Y57 (= Y56), N91 (≠ G91), H124 (≠ A125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (≠ A125), Q174 (= Q175), Y202 (= Y203), F203 (≠ G204), P204 (≠ V205), L205 (= L206), S207 (≠ R208), G208 (= G209), A211 (≠ S212), K213 (≠ H214)
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
34% identity, 92% coverage: 1:309/335 of query aligns to 1:310/333 of 1pz1A
- active site: D52 (= D51), Y57 (= Y56), K90 (≠ P89), Q93 (≠ A92), H125 (≠ A125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (≠ M21), Q175 (= Q175), Y203 (= Y203), G204 (= G204), L206 (= L206), R208 (= R208), K214 (≠ H214), G280 (= G279), R282 (= R281), Q286 (≠ R285)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 92% coverage: 1:309/335 of query aligns to 1:310/331 of P80874
- TW 20:21 (≠ CM 20:21) binding NADP(+)
- D52 (= D51) binding NADP(+)
- Q175 (= Q175) binding NADP(+)
- YGSLCR 203:208 (≠ YGVLSR 203:208) binding NADP(+)
- K214 (≠ H214) binding NADP(+)
- R227 (= R227) binding NADP(+)
- GAR 280:282 (= GAR 279:281) binding NADP(+)
- Q286 (≠ R285) binding NADP(+)
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 91% coverage: 16:319/335 of query aligns to 12:323/333 of O14295
- S292 (≠ E288) modified: Phosphoserine
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 92% coverage: 1:309/335 of query aligns to 1:316/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (= L26), D49 (= D51), Y54 (= Y56), S151 (= S155), Y204 (= Y203), F205 (≠ G204), L207 (= L206), Q209 (≠ R208), G210 (= G209), T213 (≠ S212), K215 (≠ H214), R227 (= R227), V284 (≠ L277), G286 (= G279), Q292 (≠ R285), N296 (≠ S289)
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 90% coverage: 1:301/335 of query aligns to 1:313/326 of P77256
- D232 (= D218) mutation D->A,E: Converts the protein into an enzyme with dual specificity, i.e. that is able to use both NADPH and NADH as cosubstrates.
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
33% identity, 92% coverage: 1:309/335 of query aligns to 1:292/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), Y50 (= Y56), H117 (≠ A125), S147 (= S155), Y200 (= Y203), F201 (≠ G204), L203 (= L206), Q205 (≠ R208), T209 (≠ S212), Q268 (≠ R285), N272 (≠ S289)
8jwmB Crystal structure of akrtyl-NADP-tylosin complex (see paper)
31% identity, 96% coverage: 1:320/335 of query aligns to 1:330/331 of 8jwmB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D51), Y53 (= Y56), N161 (≠ E156), Q186 (= Q175), W214 (≠ Y203), S215 (≠ G204), P216 (≠ V205), L217 (= L206), G219 (≠ R208), G220 (= G209), R235 (≠ F226), R236 (= R227), A237 (≠ S228), I287 (≠ L277), G289 (= G279), R291 (= R281), Q295 (≠ R285), S298 (≠ E288)
- binding tylosin: Y53 (= Y56), W55 (≠ M58), H130 (≠ A125), C192 (≠ V181), E193 (≠ S182), R195 (≠ G184), G240 (≠ P231), R241 (= R232), Q250 (≠ H240), E253 (≠ S243), Q254 (≠ L244), R257 (≠ A247), E317 (≠ T307), I318 (≠ A308), P320 (= P310)
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
31% identity, 87% coverage: 16:306/335 of query aligns to 28:286/286 of 8hnqA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G31 (= G19), M33 (= M21), R34 (≠ G22), Y71 (= Y56), R138 (= R126), Q187 (= Q175), W214 (≠ Y203), A215 (≠ G204), P216 (≠ V205), L217 (= L206), S219 (≠ R208), G220 (= G209), I257 (≠ L277), P258 (≠ V278), G259 (= G279), T260 (≠ A280), K262 (≠ R282), H265 (≠ R285), E268 (= E288), N269 (≠ S289)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L98 (≠ A85), W106 (= W93), R138 (= R126)
8jwkD The second purified state crystal structure of akrtyl (see paper)
30% identity, 96% coverage: 1:320/335 of query aligns to 1:313/314 of 8jwkD
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D51), Y53 (= Y56), H130 (≠ A125), Q186 (= Q175), W214 (≠ Y203), S215 (≠ G204), P216 (≠ V205), L217 (= L206), I270 (≠ L277), G272 (= G279), R274 (= R281), Q278 (≠ R285), S281 (≠ E288)
8jwoL Crystal structure of akrtyl-tylosin complex (see paper)
30% identity, 96% coverage: 1:320/335 of query aligns to 1:310/311 of 8jwoL
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
28% identity, 92% coverage: 1:307/335 of query aligns to 1:272/274 of 5danA
- active site: D53 (= D51), Y58 (= Y56), K84 (= K82), H117 (≠ A125)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), T20 (≠ C20), W21 (≠ M21), D53 (= D51), Y58 (= Y56), H117 (≠ A125), Q169 (= Q175), Y198 (= Y203), S199 (≠ G204), P200 (≠ V205), L201 (= L206), R203 (= R208), Y226 (≠ A260), I242 (≠ L277), P243 (≠ V278), K244 (≠ G279), G246 (≠ R281), R247 (= R282), H250 (≠ R285), E253 (= E288), N254 (≠ S289)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
28% identity, 92% coverage: 1:307/335 of query aligns to 2:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (≠ M21), Y59 (= Y56), W87 (= W93), H118 (≠ A125), R204 (= R208)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), T21 (≠ C20), W22 (≠ M21), Y59 (= Y56), H118 (≠ A125), N149 (≠ E156), Q170 (= Q175), Y199 (= Y203), S200 (≠ G204), P201 (≠ V205), L202 (= L206), R204 (= R208), T205 (≠ G209), Y227 (≠ A260), I243 (≠ L277), P244 (≠ V278), K245 (≠ G279), G247 (≠ R281), R248 (= R282), H251 (≠ R285), E254 (= E288), N255 (≠ S289)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
28% identity, 92% coverage: 1:307/335 of query aligns to 2:273/275 of 6kikA
8jwkH The second purified state crystal structure of akrtyl (see paper)
30% identity, 96% coverage: 1:320/335 of query aligns to 1:306/307 of 8jwkH
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), M21 (= M21), D48 (= D51), Y53 (= Y56), H129 (≠ A125), N160 (≠ E156), Q185 (= Q175), W213 (≠ Y203), S214 (≠ G204), P215 (≠ V205), L216 (= L206), G218 (≠ R208), I263 (≠ L277), G265 (= G279), R267 (= R281), Q271 (≠ R285), S274 (≠ E288)
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 93% coverage: 6:317/335 of query aligns to 12:350/351 of Q9P7U2
- S113 (≠ G91) modified: Phosphoserine
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
33% identity, 63% coverage: 1:212/335 of query aligns to 2:206/298 of 1ynqB
- active site: D47 (= D51), Y52 (= Y56), K86 (= K82), H120 (≠ A125)
- binding beta-D-fructofuranose: K4 (≠ T3), N44 (≠ T48), D71 (= D75)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), C21 (= C20), M22 (= M21), S23 (≠ G22), D47 (= D51), Y52 (= Y56), K77 (≠ V81), S150 (= S155), M170 (≠ Q175), R197 (≠ Y203), G198 (= G204), P199 (≠ V205), V200 (≠ L206), R202 (= R208), S206 (= S212)
Sites not aligning to the query:
Query Sequence
>WP_061942678.1 NCBI__GCF_001584185.1:WP_061942678.1
MKTQQLGSTGPQSSVIGLGCMGMSDLYGPADETESIATLHAAIDAGITLLDTGDFYGMGH
NEMLIREALRSRKRDQVLLSVKFGAMRDPAGAWIGSDGRPEAVKNFLSYTLRRLGTDHID
IYRPARLDPNVPIEETVGAIADLVKAGYVRHIGLSEVGVQTIRRAQAVHPISDLQIEYSL
VSRGIEAEILPVCRELGIGVTAYGVLSRGLISGHWNKDKTLTPGDFRSRSPRFSGDNLAH
NLSLLDALRAIADSKQATVAQIAIAWVMSRGSDIVPLVGARRRDRLAESLGATNVQLSAD
DLARIETALPAGAIAGERYAPVMMAHLDSEHPHAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory