Comparing WP_061944649.1 NCBI__GCF_001584185.1:WP_061944649.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15) (Caulobacter crescentus) (see paper)
35% identity, 98% coverage: 3:290/295 of query aligns to 4:283/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
35% identity, 98% coverage: 3:290/295 of query aligns to 4:283/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
35% identity, 98% coverage: 3:290/295 of query aligns to 4:283/289 of 7plbB
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 13:282/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 13:282/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 13:282/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 13:282/297 of 4gn7A
4gncA Human smp30/gnl-1,5-ag complex (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 14:283/298 of 4gncA
Sites not aligning to the query:
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
30% identity, 91% coverage: 13:281/295 of query aligns to 13:282/297 of 3g4hA
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
30% identity, 91% coverage: 13:281/295 of query aligns to 15:284/299 of Q15493
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
28% identity, 90% coverage: 14:278/295 of query aligns to 15:289/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
28% identity, 90% coverage: 14:278/295 of query aligns to 15:289/307 of 5d9bA
2dsoC Crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus (see paper)
24% identity, 74% coverage: 24:240/295 of query aligns to 52:271/323 of 2dsoC
Sites not aligning to the query:
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
26% identity, 80% coverage: 24:258/295 of query aligns to 19:269/293 of 7risA
Sites not aligning to the query:
Q99QV3 Lactonase drp35; EC 3.1.1.- from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see paper)
23% identity, 74% coverage: 24:240/295 of query aligns to 54:273/324 of Q99QV3
Sites not aligning to the query:
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
25% identity, 80% coverage: 24:258/295 of query aligns to 21:269/293 of 8dk0A
Sites not aligning to the query:
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
25% identity, 80% coverage: 24:258/295 of query aligns to 21:269/293 of 8djzA
Sites not aligning to the query:
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
25% identity, 80% coverage: 24:258/295 of query aligns to 21:269/293 of 8djfA
Sites not aligning to the query:
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
24% identity, 80% coverage: 24:258/295 of query aligns to 19:282/306 of 7rizA
Sites not aligning to the query:
>WP_061944649.1 NCBI__GCF_001584185.1:WP_061944649.1
MNQIAAAYDVPMQLGECPLWHAAEASLYWVDISAMQVHRLHPADGKHAMWQLDAEPGCIG
LRVGGGLVVAMRTGVAYLDTDTGALTHIADAPYDTATARFNDGRSDAAGRFWAGTIYEPR
DHAGAQLYAIEKGVVRAAGNPVTVSNGLGFSGDSRTLYHSDTTAHRITRYEFDLASGKIG
SGHVLKQFAMDKNAPDYGGRPDGAAVDSEDAYWCAMYEGGRLLRLSPSGEVLQEVIVPVR
CPTMMAFGGPDLRTLYITSVREKRSQAELEQYPLSGCVLALRVDVPGRSEPAYIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory