SitesBLAST
Comparing WP_066917916.1 NCBI__GCF_001579945.1:WP_066917916.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
43% identity, 94% coverage: 18:590/611 of query aligns to 93:656/664 of P09114
- P191 (= P125) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W507) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 92:679/687 of P07342
- R241 (= R174) binding FAD
- 355:376 (vs. 286:307, 55% identical) binding FAD
- 407:426 (vs. 330:352, 26% identical) binding FAD
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
43% identity, 94% coverage: 18:590/611 of query aligns to 96:659/667 of P09342
- C161 (= C92) modified: Disulfide link with 307
- P194 (= P125) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V242) modified: Disulfide link with 161
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 12:599/607 of 6u9dB
- active site: Y33 (= Y37), G35 (= G39), G36 (= G40), A37 (= A41), I38 (= I42), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M274 (= M285), V301 (= V312), V417 (= V418), G443 (= G444), M445 (= M446), D470 (= D471), N497 (= N498), E499 (≠ G500), Q500 (≠ D501), M502 (= M503), V503 (= V504), W506 (= W507)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G40), V111 (= V124), P112 (= P125), F121 (= F134), K171 (= K184), D299 (= D310), R300 (= R311), M502 (= M503), W506 (= W507)
- binding flavin-adenine dinucleotide: R161 (= R174), A228 (≠ G240), G229 (= G241), N232 (vs. gap), T254 (= T265), L255 (= L266), Q256 (≠ M267), L272 (= L283), M274 (= M285), G294 (= G305), R296 (= R307), D298 (= D309), R300 (= R311), V301 (= V312), E327 (≠ D330), V328 (≠ I331), N332 (≠ E335), D346 (≠ E352), A347 (= A353), M422 (= M423), G440 (= G441), G441 (≠ S442)
- binding magnesium ion: D470 (= D471), N497 (= N498)
- binding thiamine diphosphate: E59 (= E72), P85 (= P98), V417 (= V418), G418 (= G419), Q419 (= Q420), H420 (= H421), G443 (= G444), M445 (= M446), A471 (≠ S472), S472 (= S473), N497 (= N498), E499 (≠ G500), Q500 (≠ D501), G501 (= G502), M502 (= M503), V503 (= V504)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 8:588/596 of 1t9cA
- active site: Y29 (= Y37), G31 (= G39), G32 (= G40), A33 (= A41), I34 (= I42), E55 (= E72), T78 (= T95), F117 (= F134), Q118 (= Q135), E119 (= E136), K167 (= K184), R227 (≠ Q249), M263 (= M285), V290 (= V312), V406 (= V418), L431 (≠ M443), G432 (= G444), M434 (= M446), D459 (= D471), N486 (= N498), E488 (≠ G500), Q489 (≠ D501), M491 (= M503), V492 (= V504), W495 (= W507), L517 (≠ A531), G522 (= G536), L523 (≠ F537), K556 (≠ P571)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G40), V107 (= V124), P108 (= P125), F117 (= F134), K167 (= K184), D288 (= D310), R289 (= R311), W495 (= W507)
- binding flavin-adenine dinucleotide: R157 (= R174), G216 (= G239), A217 (≠ G240), G218 (= G241), N221 (vs. gap), T243 (= T265), L244 (= L266), Q245 (≠ M267), L261 (= L283), M263 (= M285), H264 (= H286), G283 (= G305), A284 (= A306), R285 (= R307), D287 (= D309), R289 (= R311), V290 (= V312), E316 (≠ D330), V317 (≠ I331), N321 (≠ E335), G334 (≠ P351), D335 (≠ E352), A336 (= A353), M411 (= M423), G429 (= G441), G430 (≠ S442)
- binding magnesium ion: D459 (= D471), N486 (= N498), E488 (≠ G500)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 8:588/596 of 1t9dA
- active site: Y29 (= Y37), G31 (= G39), G32 (= G40), A33 (= A41), I34 (= I42), E55 (= E72), T78 (= T95), F117 (= F134), Q118 (= Q135), E119 (= E136), K167 (= K184), R227 (≠ Q249), M263 (= M285), V290 (= V312), V406 (= V418), L431 (≠ M443), G432 (= G444), M434 (= M446), D459 (= D471), N486 (= N498), E488 (≠ G500), Q489 (≠ D501), M491 (= M503), V492 (= V504), W495 (= W507), L517 (≠ A531), G522 (= G536), L523 (≠ F537), K556 (≠ P571)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G40), A33 (= A41), V107 (= V124), P108 (= P125), F117 (= F134), K167 (= K184), M263 (= M285), D288 (= D310), R289 (= R311), W495 (= W507)
- binding flavin-adenine dinucleotide: R157 (= R174), G216 (= G239), A217 (≠ G240), G218 (= G241), N221 (vs. gap), T243 (= T265), L244 (= L266), Q245 (≠ M267), M260 (= M282), L261 (= L283), H264 (= H286), G283 (= G305), A284 (= A306), R285 (= R307), D287 (= D309), R289 (= R311), V290 (= V312), E316 (≠ D330), V317 (≠ I331), N321 (≠ E335), G334 (≠ P351), D335 (≠ E352), A336 (= A353), Q410 (= Q422), M411 (= M423), G429 (= G441), G430 (≠ S442)
- binding magnesium ion: D459 (= D471), N486 (= N498), E488 (≠ G500)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E72), P81 (= P98), Q118 (= Q135), G432 (= G444), M434 (= M446), M464 (= M476)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 9:589/597 of 1t9aA
- active site: Y30 (= Y37), G32 (= G39), G33 (= G40), A34 (= A41), I35 (= I42), E56 (= E72), T79 (= T95), F118 (= F134), Q119 (= Q135), E120 (= E136), K168 (= K184), R228 (≠ Q249), M264 (= M285), V291 (= V312), V407 (= V418), L432 (≠ M443), G433 (= G444), M435 (= M446), D460 (= D471), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), M492 (= M503), V493 (= V504), W496 (= W507), L518 (≠ A531), G523 (= G536), L524 (≠ F537), K557 (≠ P571)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G40), V108 (= V124), P109 (= P125), F118 (= F134), K168 (= K184), M264 (= M285), D289 (= D310), R290 (= R311), M492 (= M503), V493 (= V504), W496 (= W507)
- binding flavin-adenine dinucleotide: R158 (= R174), G217 (= G239), A218 (≠ G240), G219 (= G241), N222 (vs. gap), T244 (= T265), L245 (= L266), Q246 (≠ M267), L262 (= L283), M264 (= M285), H265 (= H286), G284 (= G305), A285 (= A306), R286 (= R307), D288 (= D309), R290 (= R311), V291 (= V312), E317 (≠ D330), V318 (≠ I331), N322 (≠ E335), G335 (≠ P351), D336 (≠ E352), A337 (= A353), Q411 (= Q422), M412 (= M423), G430 (= G441), G431 (≠ S442)
- binding magnesium ion: D460 (= D471), N487 (= N498), E489 (≠ G500)
- binding propyl trihydrogen diphosphate: V407 (= V418), G408 (= G419), Q409 (= Q420), H410 (= H421), M435 (= M446), G459 (= G470), D460 (= D471), A461 (≠ S472), S462 (= S473), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), G491 (= G502), M492 (= M503)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G444), M435 (= M446), M465 (= M476)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 12:589/597 of 6demA
- active site: Y33 (= Y37), G35 (= G39), G36 (= G40), A37 (= A41), I38 (= I42), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), K228 (≠ Q249), M264 (= M285), V291 (= V312), V407 (= V418), L432 (≠ M443), G433 (= G444), M435 (= M446), D460 (= D471), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), M492 (= M503), V493 (= V504), W496 (= W507), L518 (≠ A531), N523 (≠ G536), V524 (≠ F537)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M285), D289 (= D310), R290 (= R311), M492 (= M503), W496 (= W507), A567 (≠ P581)
- binding flavin-adenine dinucleotide: R161 (= R174), G217 (= G239), A218 (≠ G240), G219 (= G241), N222 (≠ H244), T244 (= T265), L245 (= L266), Q246 (≠ M267), L262 (= L283), G284 (= G305), A285 (= A306), R286 (= R307), D288 (= D309), R290 (= R311), V291 (= V312), E317 (≠ D330), I318 (= I331), N322 (≠ E335), D336 (≠ L349), V337 (≠ L350), M412 (= M423), G430 (= G441)
- binding magnesium ion: D460 (= D471), N487 (= N498), E489 (≠ G500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V418), G408 (= G419), Q409 (= Q420), H410 (= H421), M435 (= M446), G459 (= G470), D460 (= D471), A461 (≠ S472), S462 (= S473), M465 (= M476), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), G491 (= G502), M492 (= M503), V493 (= V504)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 12:589/597 of 6delA
- active site: Y33 (= Y37), G35 (= G39), G36 (= G40), A37 (= A41), I38 (= I42), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), K228 (≠ Q249), M264 (= M285), V291 (= V312), V407 (= V418), L432 (≠ M443), G433 (= G444), M435 (= M446), D460 (= D471), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), M492 (= M503), V493 (= V504), W496 (= W507), L518 (≠ A531), N523 (≠ G536), V524 (≠ F537)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D310), R290 (= R311), W496 (= W507)
- binding flavin-adenine dinucleotide: R161 (= R174), G217 (= G239), A218 (≠ G240), G219 (= G241), N222 (≠ H244), T244 (= T265), L245 (= L266), Q246 (≠ M267), L262 (= L283), G284 (= G305), A285 (= A306), R286 (= R307), D288 (= D309), R290 (= R311), V291 (= V312), E317 (≠ D330), I318 (= I331), N322 (≠ E335), D336 (≠ L349), V337 (≠ L350), M412 (= M423), G430 (= G441)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V418), G408 (= G419), Q409 (= Q420), H410 (= H421), G433 (= G444), M435 (= M446), G459 (= G470), D460 (= D471), A461 (≠ S472), S462 (= S473), M465 (= M476), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), G491 (= G502), M492 (= M503), V493 (= V504)
- binding magnesium ion: D460 (= D471), N487 (= N498), E489 (≠ G500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V418), G408 (= G419), Q409 (= Q420), H410 (= H421), G433 (= G444), M435 (= M446), G459 (= G470), D460 (= D471), A461 (≠ S472), S462 (= S473), M465 (= M476), N487 (= N498), E489 (≠ G500), Q490 (≠ D501), G491 (= G502), M492 (= M503), V493 (= V504)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 14:591/599 of 6denA
- active site: Y35 (= Y37), G37 (= G39), G38 (= G40), A39 (= A41), I40 (= I42), E61 (= E72), T84 (= T95), F123 (= F134), Q124 (= Q135), E125 (= E136), K173 (= K184), K230 (≠ Q249), M266 (= M285), V293 (= V312), V409 (= V418), L434 (≠ M443), G435 (= G444), M437 (= M446), D462 (= D471), N489 (= N498), E491 (≠ G500), Q492 (≠ D501), M494 (= M503), V495 (= V504), W498 (= W507), L520 (≠ A531), N525 (≠ G536), V526 (≠ F537)
- binding flavin-adenine dinucleotide: R163 (= R174), G219 (= G239), A220 (≠ G240), G221 (= G241), N224 (≠ H244), T246 (= T265), L247 (= L266), Q248 (≠ M267), L264 (= L283), G286 (= G305), A287 (= A306), R288 (= R307), D290 (= D309), R292 (= R311), V293 (= V312), E319 (≠ D330), I320 (= I331), N324 (≠ E335), D338 (≠ L349), V339 (≠ L350), M414 (= M423), G432 (= G441)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M285), D291 (= D310), R292 (= R311), W498 (= W507)
- binding magnesium ion: D462 (= D471), N489 (= N498), E491 (≠ G500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V418), G410 (= G419), Q411 (= Q420), H412 (= H421), G435 (= G444), M437 (= M446), G461 (= G470), D462 (= D471), A463 (≠ S472), S464 (= S473), N489 (= N498), E491 (≠ G500), Q492 (≠ D501), G493 (= G502), M494 (= M503), V495 (= V504)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 10:591/599 of 1n0hA
- active site: Y31 (= Y37), G33 (= G39), G34 (= G40), A35 (= A41), I36 (= I42), E57 (= E72), T80 (= T95), F119 (= F134), Q120 (= Q135), E121 (= E136), K169 (= K184), R230 (≠ Q249), M266 (= M285), V293 (= V312), V409 (= V418), L434 (≠ M443), G435 (= G444), M437 (= M446), D462 (= D471), N489 (= N498), E491 (≠ G500), Q492 (≠ D501), M494 (= M503), V495 (= V504), W498 (= W507), L520 (≠ A531), G525 (= G536), L526 (≠ F537), K559 (≠ P571)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V418), G410 (= G419), Q411 (= Q420), H412 (= H421), G435 (= G444), M437 (= M446), G461 (= G470), D462 (= D471), A463 (≠ S472), S464 (= S473), M467 (= M476), N489 (= N498), E491 (≠ G500), Q492 (≠ D501), G493 (= G502), V495 (= V504)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G40), A35 (= A41), V109 (= V124), P110 (= P125), F119 (= F134), K169 (= K184), M266 (= M285), D291 (= D310), R292 (= R311), V495 (= V504), W498 (= W507)
- binding flavin-adenine dinucleotide: R159 (= R174), G219 (= G239), A220 (≠ G240), G221 (= G241), N224 (vs. gap), T246 (= T265), L247 (= L266), Q248 (≠ M267), L264 (= L283), G265 (= G284), M266 (= M285), H267 (= H286), G286 (= G305), A287 (= A306), R288 (= R307), D290 (= D309), R292 (= R311), V293 (= V312), E319 (≠ D330), V320 (≠ I331), N324 (≠ E335), G337 (≠ P351), D338 (≠ E352), A339 (= A353), M414 (= M423), G432 (= G441), G433 (≠ S442)
- binding magnesium ion: D462 (= D471), N489 (= N498), E491 (≠ G500)
- binding thiamine diphosphate: Y31 (= Y37), E57 (= E72), P83 (= P98)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 8:583/591 of 5wkcA
- active site: Y29 (= Y37), G31 (= G39), G32 (= G40), A33 (= A41), I34 (= I42), E55 (= E72), T78 (= T95), F117 (= F134), Q118 (= Q135), E119 (= E136), K167 (= K184), R222 (≠ Q249), M258 (= M285), V285 (= V312), V401 (= V418), L426 (≠ M443), G427 (= G444), M429 (= M446), D454 (= D471), N481 (= N498), E483 (≠ G500), Q484 (≠ D501), M486 (= M503), V487 (= V504), W490 (= W507), L512 (≠ A531), G517 (= G536), L518 (≠ F537), K551 (≠ P571)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V418), G402 (= G419), Q403 (= Q420), H404 (= H421), G427 (= G444), M429 (= M446), G453 (= G470), D454 (= D471), A455 (≠ S472), S456 (= S473), M459 (= M476), N481 (= N498), E483 (≠ G500), Q484 (≠ D501), G485 (= G502), M486 (= M503), V487 (= V504)
- binding ethaneperoxoic acid: G32 (= G40), Q118 (= Q135)
- binding flavin-adenine dinucleotide: R157 (= R174), G211 (= G239), A212 (≠ G240), G213 (= G241), N216 (vs. gap), T238 (= T265), L239 (= L266), Q240 (≠ M267), L256 (= L283), M258 (= M285), G278 (= G305), A279 (= A306), R280 (= R307), R284 (= R311), V285 (= V312), E311 (≠ D330), V312 (≠ I331), N316 (≠ E335), D330 (≠ E352), A331 (= A353), M406 (= M423), G424 (= G441)
- binding magnesium ion: D454 (= D471), N481 (= N498), E483 (≠ G500)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G40), A33 (= A41), V107 (= V124), F117 (= F134), K167 (= K184), M258 (= M285), R284 (= R311), M486 (= M503), W490 (= W507)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (≠ S38), E55 (= E72)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 8:587/595 of 1t9bB
- active site: Y29 (= Y37), G31 (= G39), G32 (= G40), A33 (= A41), I34 (= I42), E55 (= E72), T78 (= T95), F117 (= F134), Q118 (= Q135), E119 (= E136), K167 (= K184), R226 (≠ Q249), M262 (= M285), V289 (= V312), V405 (= V418), L430 (≠ M443), G431 (= G444), M433 (= M446), D458 (= D471), N485 (= N498), E487 (≠ G500), Q488 (≠ D501), M490 (= M503), V491 (= V504), W494 (= W507), L516 (≠ A531), G521 (= G536), L522 (≠ F537), K555 (≠ P571)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V124), P108 (= P125), D287 (= D310), R288 (= R311), M490 (= M503), W494 (= W507)
- binding flavin-adenine dinucleotide: R157 (= R174), G215 (= G239), A216 (≠ G240), G217 (= G241), N220 (vs. gap), T242 (= T265), L243 (= L266), Q244 (≠ M267), M259 (= M282), L260 (= L283), M262 (= M285), H263 (= H286), G282 (= G305), A283 (= A306), R284 (= R307), D286 (= D309), R288 (= R311), V289 (= V312), E315 (≠ D330), V316 (≠ I331), N320 (≠ E335), G333 (≠ P351), D334 (≠ E352), A335 (= A353), Q409 (= Q422), M410 (= M423), G428 (= G441), G429 (≠ S442)
- binding magnesium ion: D458 (= D471), N485 (= N498), E487 (≠ G500)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 7:574/582 of 1t9dB
- active site: Y28 (= Y37), G30 (= G39), G31 (= G40), A32 (= A41), I33 (= I42), E54 (= E72), T77 (= T95), F116 (= F134), Q117 (= Q135), E118 (= E136), K166 (= K184), R213 (≠ Q249), M249 (= M285), V276 (= V312), V392 (= V418), L417 (≠ M443), G418 (= G444), M420 (= M446), D445 (= D471), N472 (= N498), E474 (≠ G500), Q475 (≠ D501), M477 (= M503), V478 (= V504), W481 (= W507), L503 (≠ A531), G508 (= G536), L509 (≠ F537), K542 (≠ P571)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G40), A32 (= A41), V106 (= V124), P107 (= P125), F116 (= F134), K166 (= K184), M249 (= M285), D274 (= D310), R275 (= R311), W481 (= W507)
- binding flavin-adenine dinucleotide: R156 (= R174), G202 (= G239), A203 (≠ G240), G204 (= G241), N207 (vs. gap), T229 (= T265), L230 (= L266), Q231 (≠ M267), L247 (= L283), M249 (= M285), H250 (= H286), G269 (= G305), A270 (= A306), R271 (= R307), D273 (= D309), R275 (= R311), V276 (= V312), E302 (≠ D330), V303 (≠ I331), N307 (≠ E335), G320 (≠ P351), D321 (≠ E352), A322 (= A353), Q396 (= Q422), M397 (= M423), G415 (= G441), G416 (≠ S442)
- binding magnesium ion: D445 (= D471), N472 (= N498), E474 (≠ G500)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E72), P80 (= P98), G418 (= G444), M420 (= M446), M450 (= M476)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 96% coverage: 16:603/611 of query aligns to 8:575/583 of 1t9bA
- active site: Y29 (= Y37), G31 (= G39), G32 (= G40), A33 (= A41), I34 (= I42), E55 (= E72), T78 (= T95), F117 (= F134), Q118 (= Q135), E119 (= E136), K167 (= K184), R214 (≠ Q249), M250 (= M285), V277 (= V312), V393 (= V418), L418 (≠ M443), G419 (= G444), M421 (= M446), D446 (= D471), N473 (= N498), E475 (≠ G500), Q476 (≠ D501), M478 (= M503), V479 (= V504), W482 (= W507), L504 (≠ A531), G509 (= G536), L510 (≠ F537), K543 (≠ P571)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V124), P108 (= P125), F117 (= F134), D275 (= D310), R276 (= R311), M478 (= M503), W482 (= W507)
- binding flavin-adenine dinucleotide: R157 (= R174), G203 (= G239), A204 (≠ G240), G205 (= G241), N208 (vs. gap), T230 (= T265), L231 (= L266), Q232 (≠ M267), M247 (= M282), L248 (= L283), M250 (= M285), H251 (= H286), G270 (= G305), A271 (= A306), R272 (= R307), D274 (= D309), R276 (= R311), V277 (= V312), E303 (≠ D330), V304 (≠ I331), N308 (≠ E335), D322 (≠ E352), A323 (= A353), Q397 (= Q422), M398 (= M423), G416 (= G441), G417 (≠ S442)
- binding magnesium ion: D446 (= D471), N473 (= N498), E475 (≠ G500)
7egvA Acetolactate synthase from trichoderma harzianum with inhibitor harzianic acid (see paper)
45% identity, 94% coverage: 17:589/611 of query aligns to 8:568/590 of 7egvA
- active site: Y28 (= Y37), G30 (= G39), G31 (= G40), A32 (= A41), I33 (= I42), E54 (= E72), T77 (= T95), F116 (= F134), Q117 (= Q135), K166 (= K184), E220 (≠ Q249), M256 (= M285), V283 (= V312), V400 (= V418), L425 (≠ M443), G426 (= G444), M428 (= M446), Q483 (≠ D501), M485 (= M503), V486 (= V504), W489 (= W507), L511 (≠ A531), G516 (= G536), I517 (≠ F537)
- binding flavin-adenine dinucleotide: R156 (= R174), G209 (= G239), Q210 (≠ G240), G211 (= G241), T236 (= T265), L237 (= L266), H238 (≠ M267), G276 (= G305), S277 (≠ A306), R278 (= R307), D280 (= D309), R282 (= R311), V283 (= V312), E309 (≠ D330), I310 (= I331), D328 (≠ L349), V329 (≠ L350), M405 (= M423), G423 (= G441), G424 (≠ S442)
- binding (2S)-3-methyl-2-[[(2S,4R)-1-methyl-4-[(2E,4E)-octa-2,4-dienoyl]-3,5-bis(oxidanylidene)pyrrolidin-2-yl]methyl]-2-oxidanyl-butanoic acid: F493 (= F511), Y494 (≠ F512)
- binding magnesium ion: D453 (= D471), N480 (= N498), E482 (≠ G500)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: P29 (≠ S38), E54 (= E72), Q117 (= Q135), V400 (= V418), G401 (= G419), Q402 (= Q420), H403 (= H421), G426 (= G444), M428 (= M446), D453 (= D471), A454 (≠ S472), S455 (= S473), E482 (≠ G500), Q483 (≠ D501), G484 (= G502), M485 (= M503), V486 (= V504)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
42% identity, 94% coverage: 18:590/611 of query aligns to 13:576/582 of 3ea4A
- active site: Y32 (= Y37), G34 (= G39), G35 (= G40), A36 (= A41), S37 (≠ I42), E58 (= E72), T81 (= T95), F120 (= F134), Q121 (= Q135), E122 (= E136), K170 (= K184), M265 (= M285), V292 (= V312), V399 (= V418), G425 (= G444), M427 (= M446), D452 (= D471), N479 (= N498), H481 (≠ G500), L482 (≠ D501), M484 (= M503), V485 (= V504), W488 (= W507), H557 (≠ P571)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D310), R291 (= R311), W488 (= W507), S567 (≠ P581)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R174), G221 (= G239), G222 (= G240), G223 (= G241), T245 (= T265), L246 (= L266), M247 (= M267), L263 (= L283), G264 (= G284), M265 (= M285), H266 (= H286), G285 (= G305), R287 (= R307), D289 (= D309), R291 (= R311), D309 (= D330), I310 (= I331), G327 (= G348), D328 (≠ L349), V329 (≠ L350), M404 (= M423), G422 (= G441)
- binding magnesium ion: D452 (= D471), N479 (= N498), H481 (≠ G500)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V418), G400 (= G419), Q401 (= Q420), H402 (= H421), M427 (= M446), G451 (= G470), D452 (= D471), G453 (≠ S472), S454 (= S473), N479 (= N498), H481 (≠ G500), L482 (≠ D501), G483 (= G502), M484 (= M503), V485 (= V504)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
42% identity, 94% coverage: 18:590/611 of query aligns to 13:576/582 of 3e9yA
- active site: Y32 (= Y37), G34 (= G39), G35 (= G40), A36 (= A41), S37 (≠ I42), E58 (= E72), T81 (= T95), F120 (= F134), Q121 (= Q135), E122 (= E136), K170 (= K184), M265 (= M285), V292 (= V312), V399 (= V418), G425 (= G444), M427 (= M446), D452 (= D471), N479 (= N498), H481 (≠ G500), L482 (≠ D501), M484 (= M503), V485 (= V504), W488 (= W507), H557 (≠ P571)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D310), R291 (= R311), W488 (= W507), S567 (≠ P581)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R174), G221 (= G239), G222 (= G240), G223 (= G241), T245 (= T265), L246 (= L266), M247 (= M267), L263 (= L283), G285 (= G305), R287 (= R307), D289 (= D309), R291 (= R311), D309 (= D330), I310 (= I331), G327 (= G348), D328 (≠ L349), V329 (≠ L350), M404 (= M423), G422 (= G441)
- binding magnesium ion: D452 (= D471), N479 (= N498), H481 (≠ G500)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V418), G400 (= G419), Q401 (= Q420), H402 (= H421), M427 (= M446), G451 (= G470), G453 (≠ S472), S454 (= S473), N479 (= N498), H481 (≠ G500), L482 (≠ D501), G483 (= G502), M484 (= M503), V485 (= V504)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
41% identity, 94% coverage: 18:590/611 of query aligns to 99:662/670 of P17597
- A122 (= A41) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L43) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E72) binding thiamine diphosphate
- S186 (= S114) binding FAD
- P197 (= P125) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ G127) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q135) binding thiamine diphosphate
- K220 (= K148) binding (R)-imazaquin
- R246 (= R174) binding (R)-imazaquin; binding FAD
- K256 (= K184) binding chlorimuron-ethyl
- G308 (= G240) binding FAD
- TL 331:332 (= TL 265:266) binding FAD
- C340 (≠ T274) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 283:286) binding FAD
- GVRFD 371:375 (≠ GARFD 305:309) binding FAD
- DR 376:377 (= DR 310:311) binding chlorimuron-ethyl
- DI 395:396 (= DI 330:331) binding FAD
- DV 414:415 (≠ LL 349:350) binding FAD
- QH 487:488 (= QH 420:421) binding thiamine diphosphate
- GG 508:509 (≠ GS 441:442) binding FAD
- GAM 511:513 (≠ GTM 444:446) binding thiamine diphosphate
- D538 (= D471) binding Mg(2+)
- DGS 538:540 (≠ DSS 471:473) binding thiamine diphosphate
- N565 (= N498) binding Mg(2+)
- NQHLGM 565:570 (≠ NCGDGM 498:503) binding thiamine diphosphate
- H567 (≠ G500) binding Mg(2+)
- W574 (= W507) binding chlorimuron-ethyl; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P581) binding chlorimuron-ethyl; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
41% identity, 94% coverage: 18:590/611 of query aligns to 14:577/585 of 5k2oA
- active site: Y33 (= Y37), G35 (= G39), G36 (= G40), A37 (= A41), S38 (≠ I42), E59 (= E72), T82 (= T95), F121 (= F134), Q122 (= Q135), E123 (= E136), K171 (= K184), M266 (= M285), V293 (= V312), V400 (= V418), G426 (= G444), M428 (= M446), D453 (= D471), N480 (= N498), H482 (≠ G500), L483 (≠ D501), M485 (= M503), V486 (= V504), W489 (= W507), H558 (≠ P571)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M285), R292 (= R311), W489 (= W507), S568 (≠ P581)
- binding flavin-adenine dinucleotide: R161 (= R174), G222 (= G239), G223 (= G240), G224 (= G241), T246 (= T265), L247 (= L266), M248 (= M267), L264 (= L283), G286 (= G305), R288 (= R307), D290 (= D309), V293 (= V312), D310 (= D330), I311 (= I331), D329 (≠ L349), V330 (≠ L350), Q404 (= Q422), M405 (= M423), G423 (= G441)
- binding magnesium ion: D453 (= D471), N480 (= N498), H482 (≠ G500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V418), G401 (= G419), Q402 (= Q420), H403 (= H421), M428 (= M446), D453 (= D471), G454 (≠ S472), S455 (= S473), N480 (= N498), H482 (≠ G500), L483 (≠ D501), G484 (= G502), M485 (= M503), V486 (= V504)
Query Sequence
>WP_066917916.1 NCBI__GCF_001579945.1:WP_066917916.1
MNTSPVSAHALAGTSMTGAEIIVQVLADEGVDTVFGYSGGAILPTYDAIFVNNQDCERCD
RRQMSLIVPANEQGAGFMAAGYARATGKVGVCIVTSGPGATNTVTPVRDCMADSIPIVVI
CGQVPTGAIGSDAFQEAPVASIMGAVAKHVFLVTDPSKLEATIRTAFEIARSGRPGPVVI
DVPKDVQNWQGKFQGAGRLPVAGYRQRMTRLTHSVLSDARCAEFFTMLGAARRPLIYAGG
GVIHSGGSQALQEFAIEYGIPVVTTLMGLGALDTTHPLAMRMLGMHGAAFANYAVDDCDF
LFALGARFDDRVAGNPAKFAPNAKQIAQIDIDISEINKVKQVHWHHIGLLPEALRGLIDY
GRRSAFNRDWSTWRTHCDQLRRTYAMNYERDSERIQPYHVIEEINKLTRGEAIITTGVGQ
HQMWAAQYFDFRSPRLWLTSGSMGTMGFGLPAAIGAQFAQPDRLVIDIDGDSSIRMNLGE
LETVTTYGLPIKVVVLNNCGDGMVKQWQKLFFKGRLAASDRSLHKKDFLKAAEADGFPYV
MRLERPQDVARVVKEFVEFQGPAFLEVMIDPDAGVYPMVGPGQPYSEMITGEHIVSRHQI
EVRPPDASEMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory