Comparing WP_066920364.1 NCBI__GCF_001579945.1:WP_066920364.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
1vb3A Crystal structure of threonine synthase from escherichia coli
37% identity, 99% coverage: 1:430/433 of query aligns to 1:424/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
36% identity, 95% coverage: 1:410/433 of query aligns to 2:438/464 of 4f4fA
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
35% identity, 90% coverage: 1:388/433 of query aligns to 5:432/496 of 8g1yA
1kl7A Crystal structure of threonine synthase from yeast (see paper)
30% identity, 90% coverage: 3:392/433 of query aligns to 7:456/509 of 1kl7A
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 91% coverage: 1:392/433 of query aligns to 5:459/514 of Q42598
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
27% identity, 66% coverage: 104:388/433 of query aligns to 124:403/444 of 2c2bA
Sites not aligning to the query:
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 66% coverage: 104:388/433 of query aligns to 199:478/526 of Q9S7B5
Sites not aligning to the query:
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
25% identity, 65% coverage: 103:382/433 of query aligns to 56:315/350 of 2zsjA
Sites not aligning to the query:
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
25% identity, 66% coverage: 104:388/433 of query aligns to 142:405/448 of 2c2gA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
29% identity, 37% coverage: 103:261/433 of query aligns to 55:195/350 of 6nmxA
Sites not aligning to the query:
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
29% identity, 37% coverage: 103:261/433 of query aligns to 53:193/345 of 6cgqB
Sites not aligning to the query:
>WP_066920364.1 NCBI__GCF_001579945.1:WP_066920364.1
MQYISTRDETQKLTLSEAIARGIAPDGGLYVPERFPRFLNSNFEGESEIAGIGPLLLAPF
AEDDSLADELSVICREAFDFPVPLLPLEGAPAPASVLELFHGPTCAFKDIGARFLAACLQ
RIRKEAPRKLTILVATSGDTGGAVAAAFHDRPWVDVVVLYPKGLVSERQAQQLACWGGNV
RTFAVHGTFDDCQRMVKEAFQDPSLAQTHQLSSANSINIGRLLPQMTYYAKAGLEVWRQT
GQRANFIIPTGNLGNALACLWARHVGLPIGEIVLATNANQTITEYLHSGEWQPRASVPTL
ASAMDVGNPSNMERLRHLHADFETLQGQVSAFSVDDTEIRSTIRRDAHELNQLWCPHSAT
AAEVFRRLISRGARGHWVIVATAHPAKFNDIVEPHAGREVPVPSSLARLLALPRQEMELQ
PTLQALRTQMQQV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory