Comparing WP_066922139.1 NCBI__GCF_001579945.1:WP_066922139.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
38% identity, 92% coverage: 31:411/413 of query aligns to 2:391/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
38% identity, 92% coverage: 31:411/413 of query aligns to 2:391/401 of 4adbB
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
41% identity, 72% coverage: 42:338/413 of query aligns to 14:313/402 of 4jevB
Sites not aligning to the query:
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 72% coverage: 42:338/413 of query aligns to 19:318/405 of P40732
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
41% identity, 72% coverage: 42:338/413 of query aligns to 14:308/397 of 4jewA
Sites not aligning to the query:
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
41% identity, 72% coverage: 42:338/413 of query aligns to 8:302/389 of 2pb0A
Sites not aligning to the query:
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 87% coverage: 44:403/413 of query aligns to 73:444/457 of Q9M8M7
Sites not aligning to the query:
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
34% identity, 90% coverage: 39:411/413 of query aligns to 3:375/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
34% identity, 90% coverage: 39:411/413 of query aligns to 2:374/375 of 2eh6A
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
36% identity, 89% coverage: 43:411/413 of query aligns to 23:393/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 89% coverage: 43:411/413 of query aligns to 15:385/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 89% coverage: 43:411/413 of query aligns to 15:385/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
36% identity, 89% coverage: 43:411/413 of query aligns to 15:385/387 of 1vefA
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
35% identity, 90% coverage: 39:410/413 of query aligns to 3:383/388 of 3nx3A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
36% identity, 89% coverage: 44:411/413 of query aligns to 23:392/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
36% identity, 89% coverage: 44:411/413 of query aligns to 17:386/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
36% identity, 89% coverage: 44:411/413 of query aligns to 17:386/391 of 7nn4A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
35% identity, 88% coverage: 37:401/413 of query aligns to 7:378/390 of 8ht4B
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 89% coverage: 44:411/413 of query aligns to 15:382/390 of A0QYS9
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
33% identity, 90% coverage: 39:411/413 of query aligns to 2:385/385 of Q9X2A5
>WP_066922139.1 NCBI__GCF_001579945.1:WP_066922139.1
MEQAMQVDVKANMTTTQDRSGSLPAGDDVIPIGKVSPDHLAPVYAQVPLEVQDAEGVYLH
TPDGRKVLDLYGGHAVAALGYGHPRWLQALNSQARSLCFQSNAVPLDVRRRAAAKLANFC
GLGLDTVFFVNSGAEANENALKLACRMTGGTRIVAVEGSFHGRSAAAGAVTWGARQKWYG
FPQLPFDVTFIKPSDMDRLGTLIDEHTAAVIVEPVQGVAGAVDLPKEFLQALRLRCSENG
TILIFDEVQCGVGRTGYPFAANMYEITPDIITTAKALGAGFPVSAMLLADHVAAYCKLDA
MGTTFGGGPLACAVVEAVIDIIDSEQLLENVRLRSVQIRESCVVGPILGTQGAGLLLGLR
TSRPAKEVQSELLKMDILTGTSGDPHVLRILAPYVLQSEHVEQLRAALQRIEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory