SitesBLAST
Comparing WP_068166335.1 NCBI__GCF_001592305.1:WP_068166335.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 11:553/591 of 5wkcA
- active site: Y29 (≠ V25), G31 (= G27), G32 (≠ E28), A33 (≠ S29), I34 (≠ Y30), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E168), R222 (≠ A223), M258 (≠ L259), V285 (≠ T286), V401 (≠ A395), L426 (≠ N423), G427 (= G424), M429 (= M426), D454 (= D450), N481 (= N477), E483 (≠ T479), Q484 (≠ Y480), M486 (≠ T482), V487 (≠ I483), W490 (≠ H486), L512 (= L508), G517 (= G513), L518 (≠ Y514), K551 (≠ A547)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A395), G402 (= G396), Q403 (≠ N397), H404 (≠ F398), G427 (= G424), M429 (= M426), G453 (= G449), D454 (= D450), A455 (≠ G451), S456 (≠ D452), M459 (= M455), N481 (= N477), E483 (≠ T479), Q484 (≠ Y480), G485 (= G481), M486 (≠ T482), V487 (≠ I483)
- binding ethaneperoxoic acid: G32 (≠ E28), Q118 (= Q115)
- binding flavin-adenine dinucleotide: R157 (= R158), G211 (= G213), A212 (≠ G214), G213 (= G215), N216 (≠ T218), T238 (≠ A239), L239 (≠ F240), Q240 (≠ R241), L256 (≠ V257), M258 (≠ L259), G278 (= G279), A279 (≠ P280), R280 (= R281), R284 (≠ A285), V285 (≠ T286), E311 (≠ H306), V312 (≠ A307), N316 (≠ E311), D330 (≠ N323), A331 (= A324), M406 (≠ S400), G424 (≠ P421)
- binding magnesium ion: D454 (= D450), N481 (= N477), E483 (≠ T479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E28), A33 (≠ S29), V107 (= V104), F117 (= F114), K167 (≠ E168), M258 (≠ L259), R284 (≠ A285), M486 (≠ T482), W490 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P26), E55 (= E52)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 13:561/599 of 1n0hA
- active site: Y31 (≠ V25), G33 (= G27), G34 (≠ E28), A35 (≠ S29), I36 (≠ Y30), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E168), R230 (≠ A223), M266 (≠ L259), V293 (≠ T286), V409 (≠ A395), L434 (≠ N423), G435 (= G424), M437 (= M426), D462 (= D450), N489 (= N477), E491 (≠ T479), Q492 (≠ Y480), M494 (≠ T482), V495 (≠ I483), W498 (≠ H486), L520 (= L508), G525 (= G513), L526 (≠ Y514), K559 (≠ A547)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A395), G410 (= G396), Q411 (≠ N397), H412 (≠ F398), G435 (= G424), M437 (= M426), G461 (= G449), D462 (= D450), A463 (≠ G451), S464 (≠ D452), M467 (= M455), N489 (= N477), E491 (≠ T479), Q492 (≠ Y480), G493 (= G481), V495 (≠ I483)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E28), A35 (≠ S29), V109 (= V104), P110 (≠ A105), F119 (= F114), K169 (≠ E168), M266 (≠ L259), D291 (≠ E284), R292 (≠ A285), V495 (≠ I483), W498 (≠ H486)
- binding flavin-adenine dinucleotide: R159 (= R158), G219 (= G213), A220 (≠ G214), G221 (= G215), N224 (≠ T218), T246 (≠ A239), L247 (≠ F240), Q248 (≠ R241), L264 (≠ V257), G265 (= G258), M266 (≠ L259), H267 (≠ G260), G286 (= G279), A287 (≠ P280), R288 (= R281), D290 (≠ G283), R292 (≠ A285), V293 (≠ T286), E319 (≠ H306), V320 (≠ A307), N324 (≠ E311), G337 (vs. gap), D338 (≠ N323), A339 (= A324), M414 (≠ S400), G432 (≠ P421), G433 (≠ T422)
- binding magnesium ion: D462 (= D450), N489 (= N477), E491 (≠ T479)
- binding thiamine diphosphate: Y31 (≠ V25), E57 (= E52), P83 (= P78)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 11:558/596 of 1t9dA
- active site: Y29 (≠ V25), G31 (= G27), G32 (≠ E28), A33 (≠ S29), I34 (≠ Y30), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E168), R227 (≠ A223), M263 (≠ L259), V290 (≠ T286), V406 (≠ A395), L431 (≠ N423), G432 (= G424), M434 (= M426), D459 (= D450), N486 (= N477), E488 (≠ T479), Q489 (≠ Y480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (= L508), G522 (= G513), L523 (≠ Y514), K556 (≠ A547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E28), A33 (≠ S29), V107 (= V104), P108 (≠ A105), F117 (= F114), K167 (≠ E168), M263 (≠ L259), D288 (≠ E284), R289 (≠ A285), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R158), G216 (= G213), A217 (≠ G214), G218 (= G215), N221 (≠ T218), T243 (≠ A239), L244 (≠ F240), Q245 (≠ R241), M260 (≠ D256), L261 (≠ V257), H264 (≠ G260), G283 (= G279), A284 (≠ P280), R285 (= R281), D287 (≠ G283), R289 (≠ A285), V290 (≠ T286), E316 (≠ H306), V317 (≠ A307), N321 (≠ E311), G334 (vs. gap), D335 (≠ N323), A336 (= A324), Q410 (≠ A399), M411 (≠ S400), G429 (≠ P421), G430 (≠ T422)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ T479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E52), P81 (= P78), Q118 (= Q115), G432 (= G424), M434 (= M426), M464 (= M455)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 12:559/597 of 1t9aA
- active site: Y30 (≠ V25), G32 (= G27), G33 (≠ E28), A34 (≠ S29), I35 (≠ Y30), E56 (= E52), T79 (= T75), F118 (= F114), Q119 (= Q115), E120 (= E116), K168 (≠ E168), R228 (≠ A223), M264 (≠ L259), V291 (≠ T286), V407 (≠ A395), L432 (≠ N423), G433 (= G424), M435 (= M426), D460 (= D450), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486), L518 (= L508), G523 (= G513), L524 (≠ Y514), K557 (≠ A547)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ E28), V108 (= V104), P109 (≠ A105), F118 (= F114), K168 (≠ E168), M264 (≠ L259), D289 (≠ E284), R290 (≠ A285), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486)
- binding flavin-adenine dinucleotide: R158 (= R158), G217 (= G213), A218 (≠ G214), G219 (= G215), N222 (≠ T218), T244 (≠ A239), L245 (≠ F240), Q246 (≠ R241), L262 (≠ V257), M264 (≠ L259), H265 (≠ G260), G284 (= G279), A285 (≠ P280), R286 (= R281), D288 (≠ G283), R290 (≠ A285), V291 (≠ T286), E317 (≠ H306), V318 (≠ A307), N322 (≠ E311), G335 (vs. gap), D336 (≠ N323), A337 (= A324), Q411 (≠ A399), M412 (≠ S400), G430 (≠ P421), G431 (≠ T422)
- binding magnesium ion: D460 (= D450), N487 (= N477), E489 (≠ T479)
- binding propyl trihydrogen diphosphate: V407 (≠ A395), G408 (= G396), Q409 (≠ N397), H410 (≠ F398), M435 (= M426), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ D452), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), G491 (= G481), M492 (≠ T482)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G424), M435 (= M426), M465 (= M455)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 11:558/596 of 1t9cA
- active site: Y29 (≠ V25), G31 (= G27), G32 (≠ E28), A33 (≠ S29), I34 (≠ Y30), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E168), R227 (≠ A223), M263 (≠ L259), V290 (≠ T286), V406 (≠ A395), L431 (≠ N423), G432 (= G424), M434 (= M426), D459 (= D450), N486 (= N477), E488 (≠ T479), Q489 (≠ Y480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (= L508), G522 (= G513), L523 (≠ Y514), K556 (≠ A547)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E28), V107 (= V104), P108 (≠ A105), F117 (= F114), K167 (≠ E168), D288 (≠ E284), R289 (≠ A285), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R158), G216 (= G213), A217 (≠ G214), G218 (= G215), N221 (≠ T218), T243 (≠ A239), L244 (≠ F240), Q245 (≠ R241), L261 (≠ V257), M263 (≠ L259), H264 (≠ G260), G283 (= G279), A284 (≠ P280), R285 (= R281), D287 (≠ G283), R289 (≠ A285), V290 (≠ T286), E316 (≠ H306), V317 (≠ A307), N321 (≠ E311), G334 (vs. gap), D335 (≠ N323), A336 (= A324), M411 (≠ S400), G429 (≠ P421), G430 (≠ T422)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ T479)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 10:544/582 of 1t9dB
- active site: Y28 (≠ V25), G30 (= G27), G31 (≠ E28), A32 (≠ S29), I33 (≠ Y30), E54 (= E52), T77 (= T75), F116 (= F114), Q117 (= Q115), E118 (= E116), K166 (≠ E168), R213 (≠ A223), M249 (≠ L259), V276 (≠ T286), V392 (≠ A395), L417 (≠ N423), G418 (= G424), M420 (= M426), D445 (= D450), N472 (= N477), E474 (≠ T479), Q475 (≠ Y480), M477 (≠ T482), V478 (≠ I483), W481 (≠ H486), L503 (= L508), G508 (= G513), L509 (≠ Y514), K542 (≠ A547)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ E28), A32 (≠ S29), V106 (= V104), P107 (≠ A105), F116 (= F114), K166 (≠ E168), M249 (≠ L259), D274 (≠ E284), R275 (≠ A285), W481 (≠ H486)
- binding flavin-adenine dinucleotide: R156 (= R158), G202 (= G213), A203 (≠ G214), G204 (= G215), N207 (≠ T218), T229 (≠ A239), L230 (≠ F240), Q231 (≠ R241), L247 (≠ V257), M249 (≠ L259), H250 (≠ G260), G269 (= G279), A270 (≠ P280), R271 (= R281), D273 (≠ G283), R275 (≠ A285), V276 (≠ T286), E302 (≠ H306), V303 (≠ A307), N307 (≠ E311), G320 (vs. gap), D321 (≠ N323), A322 (= A324), Q396 (≠ A399), M397 (≠ S400), G415 (≠ P421), G416 (≠ T422)
- binding magnesium ion: D445 (= D450), N472 (= N477), E474 (≠ T479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E52), P80 (= P78), G418 (= G424), M420 (= M426), M450 (= M455)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 11:545/583 of 1t9bA
- active site: Y29 (≠ V25), G31 (= G27), G32 (≠ E28), A33 (≠ S29), I34 (≠ Y30), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E168), R214 (≠ A223), M250 (≠ L259), V277 (≠ T286), V393 (≠ A395), L418 (≠ N423), G419 (= G424), M421 (= M426), D446 (= D450), N473 (= N477), E475 (≠ T479), Q476 (≠ Y480), M478 (≠ T482), V479 (≠ I483), W482 (≠ H486), L504 (= L508), G509 (= G513), L510 (≠ Y514), K543 (≠ A547)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V104), P108 (≠ A105), F117 (= F114), D275 (≠ E284), R276 (≠ A285), M478 (≠ T482), W482 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R158), G203 (= G213), A204 (≠ G214), G205 (= G215), N208 (≠ T218), T230 (≠ A239), L231 (≠ F240), Q232 (≠ R241), M247 (≠ D256), L248 (≠ V257), M250 (≠ L259), H251 (≠ G260), G270 (= G279), A271 (≠ P280), R272 (= R281), D274 (≠ G283), R276 (≠ A285), V277 (≠ T286), E303 (≠ H306), V304 (≠ A307), N308 (≠ E311), D322 (≠ N323), A323 (= A324), Q397 (≠ A399), M398 (≠ S400), G416 (≠ P421), G417 (≠ T422)
- binding magnesium ion: D446 (= D450), N473 (= N477), E475 (≠ T479)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 11:557/595 of 1t9bB
- active site: Y29 (≠ V25), G31 (= G27), G32 (≠ E28), A33 (≠ S29), I34 (≠ Y30), E55 (= E52), T78 (= T75), F117 (= F114), Q118 (= Q115), E119 (= E116), K167 (≠ E168), R226 (≠ A223), M262 (≠ L259), V289 (≠ T286), V405 (≠ A395), L430 (≠ N423), G431 (= G424), M433 (= M426), D458 (= D450), N485 (= N477), E487 (≠ T479), Q488 (≠ Y480), M490 (≠ T482), V491 (≠ I483), W494 (≠ H486), L516 (= L508), G521 (= G513), L522 (≠ Y514), K555 (≠ A547)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V104), P108 (≠ A105), D287 (≠ E284), R288 (≠ A285), M490 (≠ T482), W494 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R158), G215 (= G213), A216 (≠ G214), G217 (= G215), N220 (≠ T218), T242 (≠ A239), L243 (≠ F240), Q244 (≠ R241), M259 (≠ D256), L260 (≠ V257), M262 (≠ L259), H263 (≠ G260), G282 (= G279), A283 (≠ P280), R284 (= R281), D286 (≠ G283), R288 (≠ A285), V289 (≠ T286), E315 (≠ H306), V316 (≠ A307), N320 (≠ E311), G333 (vs. gap), D334 (≠ N323), A335 (= A324), Q409 (≠ A399), M410 (≠ S400), G428 (≠ P421), G429 (≠ T422)
- binding magnesium ion: D458 (= D450), N485 (= N477), E487 (≠ T479)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 15:569/607 of 6u9dB
- active site: Y33 (≠ V25), G35 (= G27), G36 (≠ E28), A37 (≠ S29), I38 (≠ Y30), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E168), M274 (≠ L259), V301 (≠ T286), V417 (≠ A395), G443 (= G424), M445 (= M426), D470 (= D450), N497 (= N477), E499 (≠ T479), Q500 (≠ Y480), M502 (≠ T482), V503 (≠ I483), W506 (≠ H486)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ E28), V111 (= V104), P112 (≠ A105), F121 (= F114), K171 (≠ E168), D299 (≠ E284), R300 (≠ A285), M502 (≠ T482), W506 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R158), A228 (≠ G214), G229 (= G215), N232 (≠ T218), T254 (≠ A239), L255 (≠ F240), Q256 (≠ R241), L272 (≠ V257), M274 (≠ L259), G294 (= G279), R296 (= R281), D298 (≠ G283), R300 (≠ A285), V301 (≠ T286), E327 (≠ H306), V328 (≠ A307), N332 (≠ E311), D346 (≠ N323), A347 (= A324), M422 (≠ S400), G440 (≠ P421), G441 (≠ T422)
- binding magnesium ion: D470 (= D450), N497 (= N477)
- binding thiamine diphosphate: E59 (= E52), P85 (= P78), V417 (≠ A395), G418 (= G396), Q419 (≠ N397), H420 (≠ F398), G443 (= G424), M445 (= M426), A471 (≠ G451), S472 (≠ D452), N497 (= N477), E499 (≠ T479), Q500 (≠ Y480), G501 (= G481), M502 (≠ T482), V503 (≠ I483)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
29% identity, 95% coverage: 7:549/569 of query aligns to 95:649/687 of P07342
- R241 (= R158) binding
- 355:376 (vs. 260:281, 32% identical) binding
- 407:426 (vs. 306:323, 25% identical) binding
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 17:563/601 of 6deqA
- active site: Y35 (≠ V25), G37 (= G27), G38 (≠ E28), A39 (≠ S29), I40 (≠ Y30), E61 (= E52), T84 (= T75), F123 (= F114), Q124 (= Q115), E125 (= E116), K173 (≠ E168), K232 (≠ A223), M268 (≠ L259), V295 (≠ T286), V411 (≠ A395), L436 (vs. gap), G437 (= G424), M439 (= M426), D464 (= D450), N491 (= N477), E493 (≠ T479), Q494 (≠ Y480), M496 (≠ T482), V497 (≠ I483), W500 (≠ H486), L522 (= L508), N527 (≠ G513), V528 (≠ Y514)
- binding flavin-adenine dinucleotide: R163 (= R158), G221 (= G213), A222 (≠ G214), G223 (= G215), N226 (≠ T218), T248 (≠ A239), L249 (≠ F240), Q250 (≠ R241), L266 (≠ V257), G288 (= G279), A289 (≠ P280), R290 (= R281), D292 (≠ G283), R294 (≠ A285), V295 (≠ T286), E321 (≠ H306), I322 (≠ A307), D340 (≠ T325), V341 (≠ M326), M416 (≠ S400), G434 (≠ T422)
- binding magnesium ion: D464 (= D450), N491 (= N477), E493 (≠ T479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ L259), R294 (≠ A285), M496 (≠ T482), V497 (≠ I483), W500 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (≠ A395), G412 (= G396), Q413 (≠ N397), H414 (≠ F398), M439 (= M426), G463 (= G449), D464 (= D450), A465 (≠ G451), S466 (≠ D452), N491 (= N477), E493 (≠ T479), Q494 (≠ Y480), G495 (= G481), M496 (≠ T482), V497 (≠ I483)
Sites not aligning to the query:
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 17:561/599 of 6denA
- active site: Y35 (≠ V25), G37 (= G27), G38 (≠ E28), A39 (≠ S29), I40 (≠ Y30), E61 (= E52), T84 (= T75), F123 (= F114), Q124 (= Q115), E125 (= E116), K173 (≠ E168), K230 (≠ A223), M266 (≠ L259), V293 (≠ T286), V409 (≠ A395), L434 (vs. gap), G435 (= G424), M437 (= M426), D462 (= D450), N489 (= N477), E491 (≠ T479), Q492 (≠ Y480), M494 (≠ T482), V495 (≠ I483), W498 (≠ H486), L520 (= L508), N525 (≠ G513), V526 (≠ Y514)
- binding flavin-adenine dinucleotide: R163 (= R158), G219 (= G213), A220 (≠ G214), G221 (= G215), N224 (≠ T218), T246 (≠ A239), L247 (≠ F240), Q248 (≠ R241), L264 (≠ V257), G286 (= G279), A287 (≠ P280), R288 (= R281), D290 (≠ G283), R292 (≠ A285), V293 (≠ T286), E319 (≠ H306), I320 (≠ A307), N324 (≠ E311), D338 (≠ T325), V339 (≠ M326), M414 (≠ S400), G432 (≠ T422)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ L259), D291 (≠ E284), R292 (≠ A285), W498 (≠ H486)
- binding magnesium ion: D462 (= D450), N489 (= N477), E491 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (≠ A395), G410 (= G396), Q411 (≠ N397), H412 (≠ F398), G435 (= G424), M437 (= M426), G461 (= G449), D462 (= D450), A463 (≠ G451), S464 (≠ D452), N489 (= N477), E491 (≠ T479), Q492 (≠ Y480), G493 (= G481), M494 (≠ T482), V495 (≠ I483)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 13:555/593 of 6deoA
- active site: Y31 (≠ V25), G33 (= G27), G34 (≠ E28), A35 (≠ S29), I36 (≠ Y30), E57 (= E52), T80 (= T75), F119 (= F114), Q120 (= Q115), E121 (= E116), K169 (≠ E168), K224 (≠ A223), M260 (≠ L259), V287 (≠ T286), V403 (≠ A395), L428 (vs. gap), G429 (= G424), M431 (= M426), D456 (= D450), N483 (= N477), E485 (≠ T479), Q486 (≠ Y480), M488 (≠ T482), V489 (≠ I483), W492 (≠ H486), L514 (= L508), N519 (≠ G513), V520 (≠ Y514)
- binding flavin-adenine dinucleotide: R159 (= R158), G213 (= G213), A214 (≠ G214), G215 (= G215), N218 (≠ T218), T240 (≠ A239), L241 (≠ F240), Q242 (≠ R241), L258 (≠ V257), G280 (= G279), A281 (≠ P280), R282 (= R281), D284 (≠ G283), R286 (≠ A285), V287 (≠ T286), E313 (≠ H306), I314 (≠ A307), N318 (≠ E311), D332 (≠ T325), V333 (≠ M326), M408 (≠ S400), G426 (≠ T422)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ L259), D285 (≠ E284), R286 (≠ A285), M488 (≠ T482), W492 (≠ H486)
- binding magnesium ion: D456 (= D450), N483 (= N477), E485 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ A395), G404 (= G396), Q405 (≠ N397), H406 (≠ F398), G429 (= G424), M431 (= M426), G455 (= G449), D456 (= D450), A457 (≠ G451), S458 (≠ D452), M461 (= M455), N483 (= N477), E485 (≠ T479), Q486 (≠ Y480), G487 (= G481), M488 (≠ T482), V489 (≠ I483)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 15:559/597 of 6demA
- active site: Y33 (≠ V25), G35 (= G27), G36 (≠ E28), A37 (≠ S29), I38 (≠ Y30), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E168), K228 (≠ A223), M264 (≠ L259), V291 (≠ T286), V407 (≠ A395), L432 (vs. gap), G433 (= G424), M435 (= M426), D460 (= D450), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486), L518 (= L508), N523 (≠ G513), V524 (≠ Y514)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ L259), D289 (≠ E284), R290 (≠ A285), M492 (≠ T482), W496 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R158), G217 (= G213), A218 (≠ G214), G219 (= G215), N222 (≠ T218), T244 (≠ A239), L245 (≠ F240), Q246 (≠ R241), L262 (≠ V257), G284 (= G279), A285 (≠ P280), R286 (= R281), D288 (≠ G283), R290 (≠ A285), V291 (≠ T286), E317 (≠ H306), I318 (≠ A307), N322 (≠ E311), D336 (≠ T325), V337 (≠ M326), M412 (≠ S400), G430 (≠ T422)
- binding magnesium ion: D460 (= D450), N487 (= N477), E489 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A395), G408 (= G396), Q409 (≠ N397), H410 (≠ F398), M435 (= M426), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ D452), M465 (= M455), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), G491 (= G481), M492 (≠ T482), V493 (≠ I483)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 15:559/597 of 6delA
- active site: Y33 (≠ V25), G35 (= G27), G36 (≠ E28), A37 (≠ S29), I38 (≠ Y30), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E168), K228 (≠ A223), M264 (≠ L259), V291 (≠ T286), V407 (≠ A395), L432 (vs. gap), G433 (= G424), M435 (= M426), D460 (= D450), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486), L518 (= L508), N523 (≠ G513), V524 (≠ Y514)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (≠ E284), R290 (≠ A285), W496 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R158), G217 (= G213), A218 (≠ G214), G219 (= G215), N222 (≠ T218), T244 (≠ A239), L245 (≠ F240), Q246 (≠ R241), L262 (≠ V257), G284 (= G279), A285 (≠ P280), R286 (= R281), D288 (≠ G283), R290 (≠ A285), V291 (≠ T286), E317 (≠ H306), I318 (≠ A307), N322 (≠ E311), D336 (≠ T325), V337 (≠ M326), M412 (≠ S400), G430 (≠ T422)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A395), G408 (= G396), Q409 (≠ N397), H410 (≠ F398), G433 (= G424), M435 (= M426), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ D452), M465 (= M455), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), G491 (= G481), M492 (≠ T482), V493 (≠ I483)
- binding magnesium ion: D460 (= D450), N487 (= N477), E489 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A395), G408 (= G396), Q409 (≠ N397), H410 (≠ F398), G433 (= G424), M435 (= M426), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ D452), M465 (= M455), N487 (= N477), E489 (≠ T479), Q490 (≠ Y480), G491 (= G481), M492 (≠ T482), V493 (≠ I483)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
30% identity, 94% coverage: 9:545/569 of query aligns to 96:635/664 of P09114
- P191 (≠ A105) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ H486) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
30% identity, 94% coverage: 9:545/569 of query aligns to 99:638/667 of P09342
- C161 (= C72) modified: Disulfide link with 307
- P194 (≠ A105) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ T218) modified: Disulfide link with 161
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 17:562/600 of 6derA
- active site: Y35 (≠ V25), G37 (= G27), G38 (≠ E28), A39 (≠ S29), I40 (≠ Y30), E61 (= E52), T84 (= T75), F123 (= F114), Q124 (= Q115), E125 (= E116), K173 (≠ E168), K231 (≠ A223), M267 (≠ L259), V294 (≠ T286), V410 (≠ A395), L435 (vs. gap), G436 (= G424), M438 (= M426), D463 (= D450), N490 (= N477), E492 (≠ T479), Q493 (≠ Y480), M495 (≠ T482), V496 (≠ I483), W499 (≠ H486), L521 (= L508), N526 (≠ G513), V527 (≠ Y514)
- binding flavin-adenine dinucleotide: R163 (= R158), G220 (= G213), A221 (≠ G214), G222 (= G215), N225 (≠ T218), T247 (≠ A239), L248 (≠ F240), Q249 (≠ R241), L265 (≠ V257), H268 (≠ G260), G287 (= G279), A288 (≠ P280), R289 (= R281), D291 (≠ G283), R293 (≠ A285), V294 (≠ T286), E320 (≠ H306), I321 (≠ A307), N325 (≠ E311), G338 (≠ A324), D339 (≠ T325), V340 (≠ M326), Q414 (≠ A399), M415 (≠ S400), G433 (≠ T422)
- binding Metosulam: R293 (≠ A285), M495 (≠ T482), W499 (≠ H486)
- binding magnesium ion: D463 (= D450), N490 (= N477), E492 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (≠ A395), G411 (= G396), Q412 (≠ N397), H413 (≠ F398), G436 (= G424), M438 (= M426), G462 (= G449), D463 (= D450), A464 (≠ G451), S465 (≠ D452), N490 (= N477), E492 (≠ T479), Q493 (≠ Y480), G494 (= G481), M495 (≠ T482), V496 (≠ I483)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (≠ A395), G411 (= G396), Q412 (≠ N397), H413 (≠ F398), G436 (= G424), M438 (= M426), G462 (= G449), D463 (= D450), A464 (≠ G451), S465 (≠ D452), M468 (= M455), N490 (= N477), E492 (≠ T479), Q493 (≠ Y480), G494 (= G481), V496 (≠ I483)
Sites not aligning to the query:
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 15:560/598 of 6desA
- active site: Y33 (≠ V25), G35 (= G27), G36 (≠ E28), A37 (≠ S29), I38 (≠ Y30), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E168), K229 (≠ A223), M265 (≠ L259), V292 (≠ T286), V408 (≠ A395), L433 (vs. gap), G434 (= G424), M436 (= M426), D461 (= D450), N488 (= N477), E490 (≠ T479), Q491 (≠ Y480), M493 (≠ T482), V494 (≠ I483), W497 (≠ H486), L519 (= L508), N524 (≠ G513), V525 (≠ Y514)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ L259), D290 (≠ E284), R291 (≠ A285), W497 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R158), G218 (= G213), A219 (≠ G214), G220 (= G215), N223 (≠ T218), T245 (≠ A239), L246 (≠ F240), Q247 (≠ R241), L263 (≠ V257), G285 (= G279), A286 (≠ P280), R287 (= R281), D289 (≠ G283), R291 (≠ A285), V292 (≠ T286), E318 (≠ H306), I319 (≠ A307), N323 (≠ E311), D337 (≠ T325), V338 (≠ M326), Q412 (≠ A399), M413 (≠ S400), G431 (≠ T422)
- binding magnesium ion: D461 (= D450), N488 (= N477), E490 (≠ T479)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A395), G409 (= G396), Q410 (≠ N397), H411 (≠ F398), G434 (= G424), M436 (= M426), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ D452), N488 (= N477), E490 (≠ T479), Q491 (≠ Y480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
28% identity, 95% coverage: 7:549/569 of query aligns to 15:560/598 of 6depA
- active site: Y33 (≠ V25), G35 (= G27), G36 (≠ E28), A37 (≠ S29), I38 (≠ Y30), E59 (= E52), T82 (= T75), F121 (= F114), Q122 (= Q115), E123 (= E116), K171 (≠ E168), K229 (≠ A223), M265 (≠ L259), V292 (≠ T286), V408 (≠ A395), L433 (vs. gap), G434 (= G424), M436 (= M426), D461 (= D450), N488 (= N477), E490 (≠ T479), Q491 (≠ Y480), M493 (≠ T482), V494 (≠ I483), W497 (≠ H486), L519 (= L508), N524 (≠ G513), V525 (≠ Y514)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ E284), R291 (≠ A285), M493 (≠ T482), W497 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R158), G218 (= G213), A219 (≠ G214), G220 (= G215), N223 (≠ T218), T245 (≠ A239), L246 (≠ F240), Q247 (≠ R241), L263 (≠ V257), G264 (= G258), G285 (= G279), A286 (≠ P280), R287 (= R281), D289 (≠ G283), R291 (≠ A285), V292 (≠ T286), E318 (≠ H306), I319 (≠ A307), N323 (≠ E311), D337 (≠ T325), V338 (≠ M326), M413 (≠ S400), G431 (≠ T422)
- binding magnesium ion: D461 (= D450), N488 (= N477), E490 (≠ T479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ A395), G409 (= G396), Q410 (≠ N397), H411 (≠ F398), G434 (= G424), M436 (= M426), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ D452), M466 (= M455), N488 (= N477), E490 (≠ T479), Q491 (≠ Y480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A395), G409 (= G396), Q410 (≠ N397), H411 (≠ F398), G434 (= G424), M436 (= M426), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ D452), M466 (= M455), N488 (= N477), E490 (≠ T479), Q491 (≠ Y480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
Query Sequence
>WP_068166335.1 NCBI__GCF_001592305.1:WP_068166335.1
MTQKIAGHLLVECLIAQGVTHAFGVPGESYLAVLDGFHAHADRIRFVINRQEGGAAFMAE
AQGKLTGRPGVCFVTRGPGATNASIGLHTAFQDSTPMVLFVGDVASDARDREAFQEVDYL
SFFGPSTKGMAKRVERIDDARRIPEYVARAFATAMNGRPGPVVLVLPEDMLTQPVDAKPL
PRVEPVQAWSDPGALRGLRELLLQAERPLVIAGGGGWTSQAAAALQRFAENWQLPVANAF
RFQDCFDNHHPNYAGDVGLGINPALAKRVRESDLLIAIGPRLGEATTGGYALIEAPVPKQ
KLVHIHASAEELNRVYQATLAINATMNAAARSLEVLTAPPGVAWGQWTQACHADYLANID
PANGGIVLPGSIDMPALIATLQQHLPADAVLTNGAGNFASWLHRFYRYHGLVKGHKTQLA
PTNGAMGYGVPAGIGAAILTGRTAFTIAGDGDFLMNGQELATAVQHGAKSIVLLLNNGTY
GTIRMHQEREYPAHVSGSDLRNPDFCALARAYGYAAERITHTAEFEPALLRALVAPSGTV
IEVTLDAEVITTRGTLSAIRQAAQKSRPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory