Comparing WP_068167541.1 NCBI__GCF_001592305.1:WP_068167541.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1NEI7 2,4-didehydro-3-deoxy-L-rhamnonate hydrolase; L-2,4-diketo-3-deoxyrhamnonate hydrolase; L-DKDR hydrolase; SpLRA6; EC 3.7.1.26 from Sphingomonas sp. (strain SKA58) (see paper)
55% identity, 98% coverage: 1:279/284 of query aligns to 1:271/285 of Q1NEI7
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
54% identity, 98% coverage: 2:279/284 of query aligns to 7:276/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
54% identity, 98% coverage: 2:279/284 of query aligns to 7:276/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
45% identity, 76% coverage: 69:284/284 of query aligns to 57:278/279 of 6v77B
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
41% identity, 75% coverage: 64:275/284 of query aligns to 80:294/301 of O06724
Sites not aligning to the query:
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
41% identity, 75% coverage: 64:275/284 of query aligns to 81:295/303 of 8sutA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 75% coverage: 64:275/284 of query aligns to 80:294/303 of 8skyB
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
36% identity, 100% coverage: 1:284/284 of query aligns to 2:276/277 of 6iymA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 77% coverage: 63:282/284 of query aligns to 56:277/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 77% coverage: 63:282/284 of query aligns to 56:277/280 of 6j5xA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
38% identity, 87% coverage: 30:275/284 of query aligns to 16:254/265 of 3r6oA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
36% identity, 79% coverage: 61:283/284 of query aligns to 49:249/252 of 3qdfA
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
36% identity, 70% coverage: 77:274/284 of query aligns to 17:209/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
36% identity, 70% coverage: 77:274/284 of query aligns to 14:206/216 of 6sbiA
1gttA Crystal structure of hpce (see paper)
39% identity, 63% coverage: 75:252/284 of query aligns to 223:392/421 of 1gttA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
36% identity, 70% coverage: 76:274/284 of query aligns to 14:207/218 of 6fogA
Sites not aligning to the query:
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
36% identity, 70% coverage: 76:274/284 of query aligns to 16:209/221 of Q6P587
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
35% identity, 73% coverage: 74:279/284 of query aligns to 16:217/219 of P76004
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
35% identity, 74% coverage: 41:250/284 of query aligns to 23:242/269 of 4dbhA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
36% identity, 71% coverage: 74:275/284 of query aligns to 23:224/233 of 6j5yA
>WP_068167541.1 NCBI__GCF_001592305.1:WP_068167541.1
MKLLRYGSPGQEKPGVLDAQGRVRDLSGEIADVAGAALLPESLARLRSLDIDSLPLVAGT
PQQDLRLGACVGQVGKFICIGLNYSDHAAESGMPVPPEPVVFNKWTSAIVGPDDAVEIPR
GSVKTDWEVELGVVIGQGGRYIEEADALSHVAGYCVVNDVSEREYQLDRSGTWDKGKGCD
TFGPTGPWLVTADEVPDPQALKMWLEVDGKRYQDGSTATMVYGVAFLISYLSRFMSLQPG
DIISTGTPPGVGLGQKPPVYLRAGQTMRLGIDGLGIQTQTTVQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory