Comparing WP_068169741.1 NCBI__GCF_001592305.1:WP_068169741.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7etiA Crystal structure of abhpai-zn-pyruvate-4-hydroxybenzaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etiA
7etfA Crystal structure of abhpai-mn-pyruvate-succinic semialdehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etfA
7eteA Crystal structure of abhpai-mg-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7eteA
7etdA Crystal structure of abhpai-zn-(4s)-kdglu complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etdA
7etcA Crystal structure of abhpai-zn-(4r)-kdgal complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etcA
7etbA Crystal structure of abhpai-mn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etbA
7etaA Crystal structure of abhpai-co-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/253 of 7etaA
7ethA Crystal structure of abhpai-zn-pyruvate-propionaldehyde complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 4:251/251 of 7ethA
7et9A Crystal structure of abhpai-zn-pyruvate complex, class ii aldolase, hpai from acinetobacter baumannii (see paper)
59% identity, 93% coverage: 6:255/269 of query aligns to 6:253/254 of 7et9A
Q47098 4-hydroxy-2-oxo-heptane-1,7-dioate aldolase; 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase; HHED aldolase; 4-hydroxy-2-ketoheptane-1,7-dioate aldolase; HKHD aldolase; EC 4.1.2.52 from Escherichia coli (see 3 papers)
60% identity, 95% coverage: 5:259/269 of query aligns to 2:255/262 of Q47098
4b5vA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with 4-hydroxyl-2-ketoheptane-1,7-dioate (see paper)
61% identity, 88% coverage: 5:241/269 of query aligns to 2:237/251 of 4b5vA
4b5tA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with ketobutyrate (see paper)
61% identity, 88% coverage: 5:241/269 of query aligns to 2:237/251 of 4b5tA
4b5sA Crystal structures of divalent metal dependent pyruvate aldolase, hpai, in complex with pyruvate (see paper)
61% identity, 88% coverage: 5:241/269 of query aligns to 2:237/251 of 4b5sA
2v5kA Class ii aldolase hpch - magnesium - oxamate complex (see paper)
61% identity, 88% coverage: 5:241/269 of query aligns to 11:246/260 of 2v5kA
P76469 2-keto-3-deoxy-L-rhamnonate aldolase; KDR aldolase; 2-dehydro-3-deoxyrhamnonate aldolase; 2-keto-3-deoxy acid sugar aldolase; EC 4.1.2.53 from Escherichia coli (strain K12) (see paper)
53% identity, 94% coverage: 6:259/269 of query aligns to 7:259/267 of P76469
2vwtA Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex (see paper)
53% identity, 93% coverage: 6:256/269 of query aligns to 7:256/256 of 2vwtA
P23522 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 from Escherichia coli (strain K12) (see paper)
47% identity, 93% coverage: 6:254/269 of query aligns to 8:254/256 of P23522
1dxfA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli in complex with pyruvate (see paper)
47% identity, 93% coverage: 6:254/269 of query aligns to 5:251/253 of 1dxfA
1dxeA 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli (see paper)
47% identity, 93% coverage: 6:254/269 of query aligns to 5:251/253 of 1dxeA
8adqA Crystal structure of holo-swhpa-mg (hydroxy ketone aldolase) from sphingomonas wittichii rw1 in complex with hydroxypyruvate and d- glyceraldehyde (see paper)
31% identity, 92% coverage: 5:251/269 of query aligns to 2:246/252 of 8adqA
>WP_068169741.1 NCBI__GCF_001592305.1:WP_068169741.1
MKIPQNTFRDALKAGQPQIGCWVGFASPDVAEALAGCGFDWLLLDGEHAPNDPRTVLDQL
RAVAPYSATHPVVRAVEANVALVKQYLDVGAQTLLIPMVDTAEQAALMVKAMRYAPEGIR
GMGAALARASRWNQVDDYLNQANGQMCLLVQAETVEAIKNLQAIAETEGVDGVFFGPADL
SASMGHRGQPGHPDVQKVILDGIATVRAAGKAAGILATDPALAQQYLDAGALFVAVGLDT
TLLVKAASGLVQRFSAGASKAPASPSGGY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory