Comparing WP_068169759.1 NCBI__GCF_001592305.1:WP_068169759.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gttA Crystal structure of hpce (see paper)
59% identity, 69% coverage: 53:228/254 of query aligns to 224:391/421 of 1gttA
O06724 Oxaloacetate tautomerase YisK; Oxaloacetate decarboxylase YisK; EC 5.3.2.2; EC 4.1.1.112 from Bacillus subtilis (strain 168) (see paper)
41% identity, 81% coverage: 46:251/254 of query aligns to 85:300/301 of O06724
Sites not aligning to the query:
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 81% coverage: 46:251/254 of query aligns to 85:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
41% identity, 81% coverage: 46:251/254 of query aligns to 86:301/303 of 8sutA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
39% identity, 90% coverage: 26:254/254 of query aligns to 40:250/252 of 3qdfA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
40% identity, 78% coverage: 54:252/254 of query aligns to 73:279/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
40% identity, 78% coverage: 54:252/254 of query aligns to 73:279/290 of 8gsrA
Q1NEI7 2,4-didehydro-3-deoxy-L-rhamnonate hydrolase; L-2,4-diketo-3-deoxyrhamnonate hydrolase; L-DKDR hydrolase; SpLRA6; EC 3.7.1.26 from Sphingomonas sp. (strain SKA58) (see paper)
40% identity, 78% coverage: 54:252/254 of query aligns to 68:274/285 of Q1NEI7
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 86% coverage: 37:254/254 of query aligns to 57:277/277 of 6iymA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
38% identity, 80% coverage: 46:249/254 of query aligns to 64:273/279 of 6v77B
P76004 Oxaloacetate tautomerase YcgM; EC 5.3.2.2 from Escherichia coli (strain K12)
39% identity, 78% coverage: 46:243/254 of query aligns to 10:211/219 of P76004
Q8R0F8 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Mus musculus (Mouse) (see paper)
35% identity, 77% coverage: 52:247/254 of query aligns to 15:212/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
35% identity, 77% coverage: 52:247/254 of query aligns to 12:209/216 of 6sbiA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 89% coverage: 27:253/254 of query aligns to 41:268/269 of 4dbhA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 78% coverage: 51:249/254 of query aligns to 67:274/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
35% identity, 78% coverage: 51:249/254 of query aligns to 67:274/280 of 6j5xA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
34% identity, 78% coverage: 52:248/254 of query aligns to 13:211/218 of 6fogA
Q6P587 Oxaloacetate tautomerase FAHD1, mitochondrial; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; ODx; YisK-like protein; EC 5.3.2.2; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 4 papers)
34% identity, 78% coverage: 52:248/254 of query aligns to 15:213/221 of Q6P587
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
31% identity, 93% coverage: 11:247/254 of query aligns to 25:256/265 of 3r6oA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
34% identity, 78% coverage: 52:248/254 of query aligns to 24:227/233 of 6j5yA
>WP_068169759.1 NCBI__GCF_001592305.1:WP_068169759.1
MKRARIAWAGAVHDATEADGQLELLTPAFKGRRVGFDEVVWLPPLAPLDRPRTVLALGLN
YADHAKELAFKAPEEPLAFVKGEASLIGHRAFTVRPDGVMFMHYECELAVVIGRAAKRVK
KADALQYVAGYTVANDYAIRDYLENWYRPNLKVKNRDTCTPIGPWLVDAADVPDPMNLAL
KTTVNGQLTQQGSTKDMIFDVPTLIEYFSRFMTLMPGDLIFTGTPDGVVDCQPGDVIVTE
IEGIGALTNTITNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory