Comparing WP_068333494.1 NCBI__GCF_001650345.1:WP_068333494.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1mxsA Crystal structure of 2-keto-3-deoxy-6-phosphogluconate (kdpg) aldolase from pseudomonas putida. (see paper)
39% identity, 94% coverage: 7:210/218 of query aligns to 10:214/216 of 1mxsA
P00885 2-dehydro-3-deoxy-phosphogluconate aldolase; KDPG-aldolase; Phospho-2-dehydro-3-deoxygluconate aldolase; Phospho-2-keto-3-deoxygluconate aldolase; EC 4.1.2.14 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
38% identity, 94% coverage: 7:210/218 of query aligns to 20:224/226 of P00885
Sites not aligning to the query:
1euaA Schiff base intermediate in kdpg aldolase from escherichia coli (see paper)
39% identity, 84% coverage: 25:207/218 of query aligns to 27:209/213 of 1euaA
P0A955 KHG/KDPG aldolase; EC 4.1.3.16; EC 4.1.2.14 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 84% coverage: 25:207/218 of query aligns to 27:209/213 of P0A955
1wauA Structure of kdpg aldolase e45n mutant (see paper)
39% identity, 84% coverage: 25:207/218 of query aligns to 27:209/213 of 1wauA
2c0aB Mechanism of the class i kdpg aldolase (see paper)
39% identity, 84% coverage: 25:207/218 of query aligns to 28:210/214 of 2c0aB
Sites not aligning to the query:
3vcrA Crystal structure of a putative kdpg (2-keto-3-deoxy-6- phosphogluconate) aldolase from oleispira antarctica (see paper)
37% identity, 96% coverage: 2:210/218 of query aligns to 3:215/216 of 3vcrA
6oviA Crystal structure of kdpg aldolase from legionella pneumophila with pyruvate captured at low ph as a covalent carbinolamine intermediate
40% identity, 84% coverage: 15:198/218 of query aligns to 14:197/210 of 6oviA
5xsfA Crystal structure of the 2-keto-3-deoxy-6-phosphogluconate aldolase of zymomonas mobilis zm4 with 3-phosphoglycerate
39% identity, 81% coverage: 10:186/218 of query aligns to 9:184/209 of 5xsfA
1wa3D Mechanism of the class i kdpg aldolase (see paper)
28% identity, 75% coverage: 8:171/218 of query aligns to 4:167/203 of 1wa3D
Sites not aligning to the query:
2v82A Kdpgal complexed to kdpgal (see paper)
31% identity, 72% coverage: 16:171/218 of query aligns to 6:165/205 of 2v82A
Sites not aligning to the query:
Q6BF16 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; 2-oxo-3-deoxygalactonate 6-phosphate aldolase; 6-phospho-2-dehydro-3-deoxygalactonate aldolase; 6-phospho-2-keto-3-deoxygalactonate aldolase; KDPGal; EC 4.1.2.21 from Escherichia coli (strain K12) (see paper)
31% identity, 72% coverage: 16:171/218 of query aligns to 7:166/205 of Q6BF16
>WP_068333494.1 NCBI__GCF_001650345.1:WP_068333494.1
MKTNTWIDALRDLRVMPVIQIENANDAVPLAKVLVENGLPAAEITFRTQAAAQAIANIRA
AYPEITLCAGTVLTPEQADAAIAAGADFVVSPGFNPTTVKYCLDNDIKIIPGVNNPSQVE
QALEMGVQAMKFFPAEASGGISMLKSLTGPYGNIQLMPTGGVKPTNLMDYLAISQVFACG
GTWIAPTAAIAANDWQSIATNVRETCKLLDQSPNQSQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory