SitesBLAST
Comparing WP_068460957.1 NCBI__GCF_001541235.1:WP_068460957.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56YA5 Serine--glyoxylate aminotransferase; Alanine--glyoxylate aminotransferase; AGT; Asparagine aminotransferase; Serine--pyruvate aminotransferase; EC 2.6.1.45; EC 2.6.1.44; EC 2.6.1.-; EC 2.6.1.51 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
46% identity, 96% coverage: 7:388/396 of query aligns to 12:394/401 of Q56YA5
- TGT 68:70 (= TGT 63:65) binding
- T148 (= T143) binding
- QK 200:201 (= QK 195:196) binding
- K201 (= K196) binding
- P251 (= P245) mutation to L: Abolishes aminotransferase activity.
- R347 (= R341) binding
6pk1A Alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana in presence of serine (see paper)
46% identity, 96% coverage: 7:388/396 of query aligns to 10:392/399 of 6pk1A
6pk3B Alanine-glyoxylate aminotransferase 1 (agt1) from arabidopsis thaliana (see paper)
46% identity, 96% coverage: 7:388/396 of query aligns to 11:393/400 of 6pk3B
3zrrA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
31% identity, 94% coverage: 11:382/396 of query aligns to 5:374/379 of 3zrrA
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: F24 (≠ H30), G58 (≠ T63), G59 (= G64), T60 (= T65), F84 (= F90), T134 (= T143), D159 (= D170), V161 (= V172), Y236 (≠ F241), T239 (= T244), R333 (= R341)
Sites not aligning to the query:
3zrqA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
31% identity, 94% coverage: 11:382/396 of query aligns to 8:377/382 of 3zrqA
3zrpA Crystal structure and substrate specificity of a thermophilic archaeal serine : pyruvate aminotransferase from sulfolobus solfataricus (see paper)
31% identity, 94% coverage: 11:382/396 of query aligns to 4:373/377 of 3zrpA
1j04A Structural mechanism of enzyme mistargeting in hereditary kidney stone disease in vitro (see paper)
31% identity, 87% coverage: 1:346/396 of query aligns to 15:362/387 of 1j04A
1vjoA Crystal structure of alanine--glyoxylate aminotransferase (alr1004) from nostoc sp. At 1.70 a resolution (see paper)
30% identity, 85% coverage: 10:346/396 of query aligns to 24:357/377 of 1vjoA
P21549 Alanine--glyoxylate aminotransferase; AGT; Serine--pyruvate aminotransferase; SPT; EC 2.6.1.44; EC 2.6.1.51 from Homo sapiens (Human) (see 24 papers)
31% identity, 87% coverage: 1:346/396 of query aligns to 18:365/392 of P21549
- R36 (≠ V18) to C: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177157
- G41 (≠ V23) to E: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177168; to R: in HP1; associated in cis with L-11 and M-340; results in loss of protein stability; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; partial mitochondrial mistargeting; intraperoxisomal protein aggregation seen; dbSNP:rs121908523; to V: in HP1; reduced alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177168
- G47 (≠ D29) to R: in HP1; associated in cis with L-11 and M-340; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity; reduced expression levels; reduced pyridoxal phosphate binding; reduced dimerization; reduced thermostability; increased propensity to aggregation; increased susceptibility to proteolytic degradation within the N-terminal region; mitochondrial mistargeting; exposure to pyridoxine can rescue the functionality by partially preventing aggregation and degradation and by redirecting all the protein to the peroxisome; dbSNP:rs180177173
- G82 (= G64) to E: in HP1; abolishes alanine--glyoxylate aminotransferase activity by interfering with pyridoxal phosphate binding; dbSNP:rs121908522
- W108 (≠ F90) to R: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs180177197
- A112 (≠ W94) to D: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs796052061
- L150 (≠ V135) to P: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177222
- F152 (≠ L137) to I: in HP1; associated in cis with L-11 and M-340; results in protein destabilization; no loss of dimerization; decreased alanine--glyoxylate aminotransferase activity; loss of alanine--glyoxylate aminotransferase activity when associated with L-11 and M-340; mitochondrial mistargeting when associated with L-11 and M-340; dbSNP:rs121908524
- G156 (≠ N141) to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; dbSNP:rs121908530
- S158 (≠ T143) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177225
- G161 (= G146) to C: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227; to R: in HP1; loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; loss of dimerization; dbSNP:rs180177227; to S: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; reduced expression levels; decreased protein stability; protein aggregation seen in the cytosol with a decreased aggregation propensity in the presence of pyridoxal phosphate; reduced peroxisomal localization; dbSNP:rs180177227
- L166 (≠ I151) to P: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177230
- G170 (≠ R155) to R: in HP1; associated in cis with L-11 and M-340; decrease in alanine--glyoxylate aminotransferase activity; loss of dimerization; partial loss of protein stability but protein stability increases in the presence of pyridoxal phosphate; causes protein aggregation; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with L-11 and M-340; results in mitochondrial mistargeting when associated with L-11 and M-340; dbSNP:rs121908529
- C173 (≠ L158) to Y: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; decreased protein stability; causes protein aggregation; dbSNP:rs180177231
- D183 (= D170) to N: in HP1; loss of alanine--glyoxylate aminotransferase activity; no loss of dimerization; no effect on protein stability; dbSNP:rs180177236
- S187 (= S174) to F: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization but improved dimerization in the presence of pyridoxal phosphate; decreased protein stability; dbSNP:rs180177238
- I202 (≠ V189) to N: in HP1; uncertain significance; dbSNP:rs536352238
- S205 (= S192) to P: in HP1; loss of alanine--glyoxylate aminotransferase activity; decreased protein stability; dbSNP:rs121908520
- K209 (= K196) mutation to R: Affects pyridoxal phosphate binding; loss of alanine--glyoxylate aminotransferase activity.
- S218 (≠ A205) to L: in HP1; loss of alanine--glyoxylate aminotransferase activity; loss of dimerization; no effect on protein stability; dbSNP:rs180177253
- R233 (≠ A220) to C: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908526; to H: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs121908527
- I244 (= I229) to T: in HP1; associated in cis with L-11 and M-340; results in protein misfolding; decreased alanine--glyoxylate aminotransferase activity in vitro; no loss of dimerization; partial mitochondrial mistargeting; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with L-11 and M-340; dbSNP:rs121908525
- C253 (≠ L238) to R: in HP1; associated in cis with L-11 and M-340; results in loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs180177264
- I279 (≠ L260) to T: in dbSNP:rs140992177
- A280 (≠ L261) to V: in dbSNP:rs73106685
- V326 (= V307) to I: in dbSNP:rs115057148
- I340 (≠ L321) to M: in allele minor; associated in cis with L-11; no effect on alanine--glyoxylate aminotransferase activity in vitro; decreased specific alanine--glyoxylate aminotransferase activity in vitro when associated with L-11; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with L-11 and I-152; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with L-11 and R-170; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with L-11 and T-244; results in mitochondrial mistargeting when associated with L-11 and R-170; dbSNP:rs4426527
Sites not aligning to the query:
- 9 T → N: no loss of alanine--glyoxylate aminotransferase activity; dbSNP:rs115014558
- 11 P → L: in allele minor; associated in cis with M-340; decreased specific alanine--glyoxylate aminotransferase activity in vitro when associated with M-340; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with I-152 and M-340; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with R-170 and M-340; loss of alanine--glyoxylate aminotransferase activity in vitro when associated with T-244 and M-340; causes mitochondrial mistargeting when associated with R-170 and M-340; dbSNP:rs34116584
6rv0A Human alanine:glyoxylate aminotransferase major allele (agt-ma); with pmp in the active site (see paper)
31% identity, 87% coverage: 1:346/396 of query aligns to 13:360/384 of 6rv0A
5hhyA Structure of human alanine:glyoxylate aminotransferase major allele (agt-ma) showing x-ray induced reduction of plp internal aldimine to 4'-deoxy-piridoxine-phosphate (plr) (see paper)
31% identity, 87% coverage: 1:346/396 of query aligns to 13:360/385 of 5hhyA
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: S76 (≠ T63), G77 (= G64), H78 (≠ T65), W103 (≠ F90), S153 (≠ T143), D178 (= D170), V180 (= V172), Q203 (= Q195), K204 (= K196), Y255 (vs. gap), T258 (= T244)
2dr1A Crystal structure of the ph1308 protein from pyrococcus horikoshii ot3
31% identity, 86% coverage: 7:348/396 of query aligns to 19:356/381 of 2dr1A
1h0cA The crystal structure of human alanine:glyoxylate aminotransferase (see paper)
31% identity, 87% coverage: 1:346/396 of query aligns to 15:360/385 of 1h0cA
- binding (aminooxy)acetic acid: P25 (= P10), G26 (= G11), L346 (≠ I332), R355 (= R341)
- binding pyridoxal-5'-phosphate: S78 (≠ T63), G79 (= G64), H80 (≠ T65), W105 (≠ F90), S153 (≠ T143), D178 (= D170), V180 (= V172), K204 (= K196)
Sites not aligning to the query:
2huuA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with alanine (see paper)
31% identity, 85% coverage: 10:347/396 of query aligns to 25:362/385 of 2huuA
2huiA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase in complex with glyoxylic acid (see paper)
31% identity, 85% coverage: 10:347/396 of query aligns to 25:362/385 of 2huiA
2hufA Crystal structure of aedes aegypti alanine glyoxylate aminotransferase (see paper)
31% identity, 85% coverage: 10:347/396 of query aligns to 25:362/385 of 2hufA
Q3LSM4 Alanine--glyoxylate aminotransferase; EC 2.6.1.44 from Aedes aegypti (Yellowfever mosquito) (Culex aegypti) (see paper)
31% identity, 85% coverage: 10:347/396 of query aligns to 25:362/393 of Q3LSM4
- SGH 78:80 (≠ TGT 63:65) binding in other chain
- S155 (≠ T143) binding ; binding
- Q205 (= Q195) binding in other chain
- K206 (= K196) modified: N6-(pyridoxal phosphate)lysine
- Y257 (vs. gap) binding
- T260 (= T244) binding
- R356 (= R341) binding
2z9xA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxyl-l-alanine (see paper)
31% identity, 93% coverage: 11:380/396 of query aligns to 16:384/392 of 2z9xA
2z9wA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxal (see paper)
31% identity, 93% coverage: 11:380/396 of query aligns to 16:384/392 of 2z9wA
2z9vA Crystal structure of pyridoxamine-pyruvate aminotransferase complexed with pyridoxamine (see paper)
31% identity, 93% coverage: 11:380/396 of query aligns to 16:384/392 of 2z9vA
Query Sequence
>WP_068460957.1 NCBI__GCF_001541235.1:WP_068460957.1
MSVQNPIFIPGPTNIPEVLRKAVDMPTIDHRSSLFGQILRPAIDGAKKVFKTTDGQLFIF
PSTGTGGWEIAITNVLSPGDKVLATCNGMFSQRWIDMCRRHQLDVTMIQQAWGDGISAER
VEKILAADKHHRISVVLATHNETATGVKSDIAALRRSLNATKHPALLFVDGVSSIGSMDF
RMDEWGVDVAVSGSQKGFMLPPGLAIVGFSARALEATENARLPRTFFDIRDMAKSNALNG
FPYTPPVGLLNGLKLSTEMLLEEGLDNVFARHHRIAEGVRAAISAWGMQLCALRPELYSD
TVSAICVPDGFDANKIVARALNAYGVAFGTGIGAVAGKVFRIGHLGSLTEAMALSGIATA
EMTMVDLGLPITLGAGTAAAQQHFRLSIESTQRKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory