SitesBLAST
Comparing WP_068465118.1 NCBI__GCF_001541235.1:WP_068465118.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4whxA X-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate
46% identity, 89% coverage: 9:271/297 of query aligns to 4:271/306 of 4whxA
2ej0B Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase with pyridoxamine 5'-phosphate
45% identity, 87% coverage: 10:267/297 of query aligns to 3:265/305 of 2ej0B
- active site: F35 (= F42), G37 (= G44), K158 (= K160), E192 (= E194), L215 (= L217)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R58 (= R61), Y163 (= Y165), E192 (= E194), G195 (= G197), E196 (≠ A198), L215 (= L217), G217 (= G219), I218 (= I220), T219 (= T221), G254 (= G256), T255 (= T257)
2ej3A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with gabapentin
44% identity, 87% coverage: 10:267/297 of query aligns to 3:257/297 of 2ej3A
- active site: F35 (= F42), G37 (= G44), K150 (= K160), E184 (= E194), L207 (= L217)
- binding [1-(aminomethyl)cyclohexyl]acetic acid: G187 (= G197), G246 (= G256), T247 (= T257), A248 (= A258)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K160), Y155 (= Y165), E184 (= E194), G187 (= G197), L207 (= L217), G209 (= G219), I210 (= I220), T211 (= T221), G246 (= G256), T247 (= T257)
2eiyA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with 4-methylvaleric acid
44% identity, 87% coverage: 10:267/297 of query aligns to 3:257/297 of 2eiyA
- active site: F35 (= F42), G37 (= G44), K150 (= K160), E184 (= E194), L207 (= L217)
- binding 4-methyl valeric acid: F35 (= F42), Y94 (= Y97), T247 (= T257), A248 (= A258)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K160), Y155 (= Y165), E184 (= E194), G187 (= G197), E188 (≠ A198), L207 (= L217), G209 (= G219), I210 (= I220), T211 (= T221), G246 (= G256), T247 (= T257)
1wrvA Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase
44% identity, 87% coverage: 10:267/297 of query aligns to 3:257/297 of 1wrvA
- active site: F35 (= F42), G37 (= G44), K150 (= K160), E184 (= E194), L207 (= L217)
- binding pyridoxal-5'-phosphate: R58 (= R61), K150 (= K160), Y155 (= Y165), E184 (= E194), G187 (= G197), L207 (= L217), G209 (= G219), I210 (= I220), T211 (= T221), T247 (= T257)
2ej2A Crystal structure of t.Th.Hb8 branched-chain amino acid aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate
43% identity, 87% coverage: 10:267/297 of query aligns to 3:254/294 of 2ej2A
- active site: F35 (= F42), G37 (= G44), K147 (= K160), E181 (= E194), L204 (= L217)
- binding 4-[(1,3-dicarboxy-propylamino)-methyl]-3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridinium: R58 (= R61), Y94 (= Y97), Y152 (= Y165), E181 (= E194), G184 (= G197), E185 (≠ A198), L204 (= L217), G206 (= G219), I207 (= I220), T208 (= T221), T244 (= T257), A245 (= A258)
1iyeA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
40% identity, 88% coverage: 14:274/297 of query aligns to 5:276/304 of 1iyeA
- active site: F33 (= F42), G35 (= G44), K156 (= K160), A157 (= A161), E190 (= E194), L214 (= L217)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: R56 (= R61), Y92 (= Y97), Y126 (= Y130), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), E194 (≠ A198), N195 (= N199), L214 (= L217), G216 (= G219), I217 (= I220), T218 (= T221), G253 (= G256), T254 (= T257), A255 (= A258)
1iydA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase (see paper)
40% identity, 88% coverage: 14:274/297 of query aligns to 5:276/304 of 1iydA
- active site: F33 (= F42), G35 (= G44), K156 (= K160), A157 (= A161), E190 (= E194), L214 (= L217)
- binding glutaric acid: Y92 (= Y97), Y126 (= Y130), A255 (= A258)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), E194 (≠ A198), L214 (= L217), G216 (= G219), I217 (= I220), T218 (= T221), T254 (= T257)
1i1mA Crystal structure of escherichia coli branched-chain amino acid aminotransferase. (see paper)
40% identity, 88% coverage: 14:274/297 of query aligns to 5:276/304 of 1i1mA
- active site: K156 (= K160)
- binding 4-methyl valeric acid: Y92 (= Y97), K156 (= K160), T254 (= T257), A255 (= A258)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), E194 (≠ A198), L214 (= L217), G216 (= G219), I217 (= I220), T218 (= T221), G253 (= G256), T254 (= T257)
1i1lA Crystal structure of eschelichia coli branched-chain amino acid aminotransferase. (see paper)
40% identity, 88% coverage: 14:274/297 of query aligns to 5:276/304 of 1i1lA
- active site: K156 (= K160)
- binding 2-methylleucine: Y92 (= Y97), K156 (= K160), T254 (= T257), A255 (= A258)
- binding pyridoxal-5'-phosphate: R56 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), G216 (= G219), I217 (= I220), T218 (= T221), T254 (= T257)
6thqB Crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis with norvaline
37% identity, 93% coverage: 14:289/297 of query aligns to 9:286/301 of 6thqB
- active site: F37 (= F42), K156 (= K160), E190 (= E194), L214 (= L217)
- binding pyridoxal-5'-phosphate: R60 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), N195 (= N199), L214 (= L217), G216 (= G219), I217 (= I220), T218 (= T221), T254 (= T257)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: R60 (= R61), Y97 (= Y97), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), E194 (≠ A198), N195 (= N199), G216 (= G219), I217 (= I220), T218 (= T221), G253 (= G256), T254 (= T257), A255 (= A258)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
36% identity, 93% coverage: 14:290/297 of query aligns to 4:282/290 of 5mr0D
- active site: F32 (= F42), G34 (= G44), K150 (= K160), E183 (= E194), L206 (= L217)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R61), G100 (= G110), L101 (≠ V111), K150 (= K160), Y154 (= Y165), E183 (= E194), G186 (= G197), D187 (≠ A198), L206 (= L217), I209 (= I220), T210 (= T221), G245 (= G256), T246 (= T257)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
35% identity, 92% coverage: 13:285/297 of query aligns to 4:278/290 of 5e25A
- active site: F33 (= F42), G35 (= G44), K151 (= K160), E184 (= E194), L207 (= L217)
- binding 2-oxoglutaric acid: Y88 (= Y97), K151 (= K160), T247 (= T257), A248 (= A258)
- binding pyridoxal-5'-phosphate: R52 (= R61), K151 (= K160), Y155 (= Y165), E184 (= E194), G187 (= G197), D188 (≠ A198), L207 (= L217), G209 (= G219), I210 (= I220), T211 (= T221), G246 (= G256), T247 (= T257)
6q8eA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form (see paper)
31% identity, 93% coverage: 14:289/297 of query aligns to 6:290/307 of 6q8eA
- active site: F34 (= F42), K156 (= K160), E190 (= E194), L214 (= L217)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R59 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), S194 (≠ A198), C195 (≠ N199), L214 (= L217), S216 (≠ G219), I217 (= I220), T218 (= T221), G254 (= G256), T255 (= T257)
6h65C Crystal structure of the branched-chain-amino-acid aminotransferase from haliangium ochraceum
30% identity, 85% coverage: 15:267/297 of query aligns to 8:267/308 of 6h65C
- active site: F35 (= F42), K158 (= K160), E192 (= E194), L216 (= L217)
- binding pyridoxal-5'-phosphate: R60 (= R61), K158 (= K160), Y163 (= Y165), E192 (= E194), A196 (= A198), L216 (= L217), S218 (≠ G219), V219 (≠ I220), T220 (= T221), G256 (= G256), T257 (= T257)
7neaA Crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum (m3 mutant). (see paper)
30% identity, 93% coverage: 14:289/297 of query aligns to 6:290/309 of 7neaA
- active site: F34 (= F42), K156 (= K160), E190 (= E194), L214 (= L217)
- binding pyridoxal-5'-phosphate: R59 (= R61), K156 (= K160), Y161 (= Y165), E190 (= E194), G193 (= G197), S194 (≠ A198), L214 (= L217), S216 (≠ G219), I217 (= I220), T218 (= T221), T255 (= T257)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 95% coverage: 13:295/297 of query aligns to 5:289/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R61), K153 (≠ A161), R157 (≠ Y165), E186 (= E194), S187 (≠ C195), A188 (≠ T196), A189 (≠ G197), S190 (≠ A198), G210 (= G219), I211 (= I220), T212 (= T221), T248 (= T257)
5fr9A Structure of transaminase ata-117 arrmut11 from arthrobacter sp. Knk168 inhibited with 1-(4-bromophenyl)-2-fluoroethylamine (see paper)
26% identity, 95% coverage: 12:292/297 of query aligns to 26:311/319 of 5fr9A
- active site: Y56 (≠ F42), K177 (≠ S159), E210 (= E194), L232 (= L217)
- binding [4-[3-(4-bromophenyl)-3-oxidanylidene-propyl]-6-methyl-5-oxidanyl-pyridin-3-yl]methyl phosphate: R75 (= R61), K177 (≠ S159), E210 (= E194), G213 (= G197), F214 (≠ A198), L232 (= L217), G234 (= G219), I235 (= I220), T236 (= T221), T272 (= T257)
9iveA Structure of wild-type aminotransferase from mycolicibacterium neoaurum in complex with llp and ala (see paper)
28% identity, 86% coverage: 12:267/297 of query aligns to 40:286/323 of 9iveA
6fteB Crystal structure of an (r)-selective amine transaminase from exophiala xenobiotica
26% identity, 93% coverage: 12:287/297 of query aligns to 28:307/321 of 6fteB
- active site: Y58 (≠ F42), K179 (= K160), E212 (= E194), L234 (= L217)
- binding pyridoxal-5'-phosphate: R77 (= R61), K179 (= K160), E212 (= E194), F216 (≠ A198), N217 (= N199), L234 (= L217), G236 (= G219), V237 (≠ I220), T238 (= T221), T274 (= T257)
Query Sequence
>WP_068465118.1 NCBI__GCF_001541235.1:WP_068465118.1
MSGPTPFHDRDGLIWLDGKMVPWREANIHVLTHALHYGSGVFEGLRAYGGEIFKLSEHSQ
RLIDSAKTLDFDIPYTAAEIDQICRDVVAANNLSDCYIRPIAWRGSEQIGVAAQATKIHL
SVAAWEWGSYFPMEQRLKGIKITMAKYRRPDPATAPSTSKAAGLYMICTIEKHRAENAGF
ADALMLDWRGRVAECTGANIFFVKDGVIHTPEADCFLNGITRRTVIDLAKKRGYQVIERA
IMPDELKDFSEVFVTGTAAEVTPVSQIGEHTYTPAEISKNLLNDYTACVQPSRKAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory