Comparing WP_068749038.1 NCBI__GCF_001601575.1:WP_068749038.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
49% identity, 99% coverage: 4:285/285 of query aligns to 1:281/281 of 6aa8E
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
48% identity, 99% coverage: 3:285/285 of query aligns to 1:282/282 of 4kugA
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
48% identity, 99% coverage: 3:283/285 of query aligns to 1:280/280 of 4kuhA
9jheA 3-hydroxybutyryl-coa dehydrogenase with NAD (see paper)
48% identity, 98% coverage: 5:284/285 of query aligns to 2:279/289 of 9jheA
9jhyB 3-hydroxybutyryl-coa dehydrogenase mutant (s117a) with acetoacetyl coa (see paper)
48% identity, 98% coverage: 5:284/285 of query aligns to 2:275/285 of 9jhyB
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
42% identity, 100% coverage: 2:285/285 of query aligns to 1:283/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
42% identity, 100% coverage: 2:285/285 of query aligns to 1:283/283 of 4pzdA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 99% coverage: 3:283/285 of query aligns to 5:286/286 of P9WNP7
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
39% identity, 99% coverage: 3:284/285 of query aligns to 27:314/314 of P00348
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
40% identity, 99% coverage: 3:284/285 of query aligns to 4:291/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
40% identity, 99% coverage: 3:284/285 of query aligns to 4:291/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
40% identity, 99% coverage: 3:284/285 of query aligns to 4:291/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
40% identity, 99% coverage: 3:284/285 of query aligns to 27:314/314 of Q16836
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
35% identity, 100% coverage: 2:285/285 of query aligns to 360:641/763 of P40939
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109 (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 332:614/726 of 8oqvA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 316:598/711 of 7o4uA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80 (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 334:616/728 of 8oqrA
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79 (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 328:610/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76 (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 328:610/723 of 8oqpA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1 (see paper)
36% identity, 99% coverage: 3:283/285 of query aligns to 333:615/728 of 8oqlA
Sites not aligning to the query:
>WP_068749038.1 NCBI__GCF_001601575.1:WP_068749038.1
MEVKKILVVGAGTMGHGIAQLVAQQGFEAYLVDREKEIVEKAFLKIKEGLMKRVEKGKIS
KEEAEKVLEKITVGTDMETFADADFVIEAVFEDVEVKKKVFEKLDKIFEPEVVLATNTTA
CSISEIATATRNRKRVIGMHFFNPPVIMKLVEIIPGLETDETTVEKTKAMALMLDKTPVV
TKIETPAGIVSRVLAALLNEAVVVYSEGVADAKDIDTAMKLGANLPMGPLELIDMIGVDI
HLAKTETLYREYGDPRYRPPYILKKMVKAGHLGRKTGRGFYIYEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory