Comparing WP_069333388.1 NCBI__GCF_003046325.1:WP_069333388.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
76% identity, 95% coverage: 23:436/436 of query aligns to 1:417/417 of 4ryaA
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
26% identity, 98% coverage: 2:427/436 of query aligns to 5:410/416 of A9CEY9
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
26% identity, 91% coverage: 25:422/436 of query aligns to 7:392/399 of 5iaiA
7qhvAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 83% coverage: 67:427/436 of query aligns to 47:380/390 of 7qhvAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
26% identity, 83% coverage: 67:427/436 of query aligns to 48:382/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 83% coverage: 67:427/436 of query aligns to 46:380/384 of 7yzsAAA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
25% identity, 88% coverage: 40:423/436 of query aligns to 21:399/407 of 1eu8A
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
28% identity, 74% coverage: 39:359/436 of query aligns to 18:335/391 of 6dtqA
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
25% identity, 88% coverage: 40:423/436 of query aligns to 62:440/450 of Q7LYW7
Sites not aligning to the query:
8s5bA Sulfoquinovosyl glycerol-binding protein SmoF (see paper)
26% identity, 83% coverage: 67:427/436 of query aligns to 41:372/377 of 8s5bA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
26% identity, 83% coverage: 67:427/436 of query aligns to 45:377/382 of 7yzuA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 77% coverage: 30:365/436 of query aligns to 11:337/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
25% identity, 77% coverage: 30:365/436 of query aligns to 11:337/388 of 3jzjA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
23% identity, 81% coverage: 69:423/436 of query aligns to 49:385/393 of 5ci5A
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
27% identity, 68% coverage: 40:334/436 of query aligns to 22:312/393 of 8artB
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
24% identity, 79% coverage: 66:410/436 of query aligns to 41:359/386 of 5ysbA
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 79% coverage: 66:410/436 of query aligns to 42:360/387 of 5ysdA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 79% coverage: 66:410/436 of query aligns to 42:360/389 of 5ysdB
Sites not aligning to the query:
4qrzA Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
26% identity, 39% coverage: 25:195/436 of query aligns to 3:175/383 of 4qrzA
Sites not aligning to the query:
4qsdA Crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound sucrose
26% identity, 39% coverage: 25:195/436 of query aligns to 3:175/382 of 4qsdA
Sites not aligning to the query:
>WP_069333388.1 NCBI__GCF_003046325.1:WP_069333388.1
MTARFRALMGACAVAALSSAAGAETITVATVNNGDMIRMQGLMSEFNAQHPDITVEWVTL
EENVLRQKVTTDIATKGGQFDVLTIGTYEVPIWGKQGWLVSLNDLPPDYDADDILPAIRN
GLTVDGELYAAPFYGESSMIMYRKDLMEKAGLTMPDAPSWDFVKEAAQKMTDKDAEVYGI
CLRGKAGWGENMAFLSAMANSYGARWFDENWQPQFDGEAWKATLTDYLDMMTNYGPPGAS
NNGFNENLALFQQGKCGMWIDATVAASFVTNPEESTVADKVGFALAPDTGKGKRANWLWA
WNLAVPAGSQKVEAAKQFIAWATSKDYAELVASKEGWANVPPGTRTSLYENPEYQKVPFA
KMTLDSINAADPTNPAVDPVPYVGVQFVAIPEFQGIGTAVGQQFSAALAGSMSAEQALQA
AQQFTTREMTRAGYIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory