Comparing WP_069664979.1 NCBI__GCF_001730305.1:WP_069664979.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 91% coverage: 1:261/287 of query aligns to 1:273/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
30% identity, 91% coverage: 1:261/287 of query aligns to 1:273/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
30% identity, 91% coverage: 1:261/287 of query aligns to 1:273/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
30% identity, 91% coverage: 1:261/287 of query aligns to 1:273/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
30% identity, 91% coverage: 1:261/287 of query aligns to 1:273/296 of 1fwkA
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
33% identity, 92% coverage: 3:266/287 of query aligns to 12:277/295 of 6cyzA
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
29% identity, 91% coverage: 1:262/287 of query aligns to 2:279/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 93% coverage: 1:268/287 of query aligns to 54:338/370 of Q8L7R2
Sites not aligning to the query:
6mdeA Mevalonate kinase from methanosarcina mazei with mevalonate bound (see paper)
23% identity, 71% coverage: 72:275/287 of query aligns to 81:292/302 of 6mdeA
Sites not aligning to the query:
>WP_069664979.1 NCBI__GCF_001730305.1:WP_069664979.1
MKIRVPATSANLGPGFDSCGIALSQYLSIEVLENAEEWKIIHSLGADIPSDKTNLLLQTA
LKLAPNLAPKVLKMTSDIPLARGLGSSSSVIVAGIELANRLGNLNLSQKEKLRIATEIEG
HPDNVAPAICGDFVVASYVDGDVHYVKHHFPMCDVIAYVPDEHLLTTESRSVLPNTMPYK
DAVKASSIANVMIAAILNGNLPLAGLMMEEDRWHEAYRRKLVPHLDQIRELGQKIGIYGA
FLSGAGPTVLILTPEENTSQMVKALEKMPKSATINVLSIDQEGTQVF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory