Comparing WP_072908920.1 NCBI__GCF_900142125.1:WP_072908920.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bshA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with l-proline (see paper)
47% identity, 98% coverage: 5:267/269 of query aligns to 9:271/272 of 5bshA
5bsgA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NADP+ (see paper)
47% identity, 98% coverage: 5:267/269 of query aligns to 9:271/272 of 5bsgA
5bsfA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with NAD+ (see paper)
47% identity, 98% coverage: 5:267/269 of query aligns to 9:271/272 of 5bsfA
5bseA Crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) (see paper)
47% identity, 98% coverage: 5:267/269 of query aligns to 9:271/272 of 5bseA
6xp0A Structure of human pycr1 complexed with n-formyl l-proline (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 5:267/272 of 6xp0A
8tcvB Structure of pycr1 complexed with 4-bromobenzene-1,3-dicarboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 9:274/279 of 8tcvB
8tcuA Structure of pycr1 complexed with 2-chloro-5-(2-oxoimidazolidin-1-yl) benzoic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/279 of 8tcuA
6xp3A Structure of human pycr1 complexed with cyclopentanecarboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 6:271/276 of 6xp3A
5uauA Structure of human pycr-1 complexed with proline (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 3:268/274 of 5uauA
8tddA Structure of pycr1 complexed with nadh and 2-(furan-2-yl)acetic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 6:271/278 of 8tddA
5uatC Structure of human pycr-1 complexed with NADPH (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 7:272/277 of 5uatC
8td5A Structure of pycr1 complexed with nadh and tetrahydrothiophene-2- carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/280 of 8td5A
8td4A Structure of pycr1 complexed with nadh and 1,3-dithiolane-2-carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 6:271/279 of 8td4A
8td1A Structure of pycr1 complexed with 3-(6-oxa-9-azaspiro(4.5)decane-9- carbonyl)benzoic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/280 of 8td1A
8td0A Structure of pycr1 complexed with 5-oxo-7a-phenyl-hexahydropyrrolo[2, 1-b][1,3]thiazole-3-carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/280 of 8td0A
8tczA Structure of pycr1 complexed with 2-(pyridin-2-yl)cyclopropane-1- carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/280 of 8tczA
8tcxA Structure of pycr1 complexed with 2,4-dioxo-1,2,3,4- tetrahydroquinazoline-6-carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 10:275/280 of 8tcxA
8tdbA Structure of pycr1 complexed with nadh and 1-hydroxyethane-1-sulfonate (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 3:268/275 of 8tdbA
8tdcA Structure of pycr1 complexed with nadh and 1,3-dithiane-2-carboxylic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 4:269/276 of 8tdcA
8td9A Structure of pycr1 complexed with nadh and l-pipecolic acid (see paper)
42% identity, 97% coverage: 7:267/269 of query aligns to 7:272/279 of 8td9A
>WP_072908920.1 NCBI__GCF_900142125.1:WP_072908920.1
MTNVHKIGFIGGGNMAEALIKGLIAGGFPVDRIMASEPSEYRRDHLSEEYGIELTADNVE
LLEKCEIVVLSIKPQIADEVLQEISSAYTNEKLLVSILAGVSCKQIEKHLVGKPRVVRVM
PNTPALVSEGASAICRGHNSTKEDLDMVKQLFESVGKVQVIDERQMDAATGLSGSGPAYI
YTVVEALADGGVREGLRRDVAHALAVQTVVGAALMVRETGEHPAILRDRVCSPGGTAITG
VSTLEKKGLRTTLMEAVSAAANRSRELGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory