SitesBLAST
Comparing WP_072909508.1 NCBI__GCF_900142125.1:WP_072909508.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
54% identity, 64% coverage: 5:518/809 of query aligns to 317:832/841 of 8g3hA
- binding cobalamin: Q328 (= Q16), T330 (≠ I18), S331 (≠ P19), F675 (= F358), V685 (= V368), K693 (= K376), G720 (= G404), V722 (= V406), H723 (= H407), D724 (= D408), I725 (= I409), G726 (= G410), V730 (= V414), M767 (≠ L451), S768 (= S452), L770 (= L454), V772 (= V456), I795 (≠ L479), L796 (= L480), G797 (= G481), G798 (= G482), A799 (= A483), Y818 (= Y504), A819 (≠ C505), E820 (≠ A506), D821 (= D507)
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
46% identity, 62% coverage: 310:809/809 of query aligns to 2:506/507 of 8sseA
- binding cobalamin: H97 (= H407), G100 (= G410), V104 (= V414), S142 (= S452), L145 (= L455), V146 (= V456), I169 (≠ L479), G171 (= G481), G172 (= G482), A173 (= A483), H405 (= H708), V409 (= V712), S451 (≠ G754), F452 (= F755), G453 (= G756), Y454 (= Y757), Q463 (≠ H766), L485 (≠ M788), E488 (= E791), A490 (≠ S793), S492 (= S795)
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
29% identity, 97% coverage: 23:809/809 of query aligns to 359:1192/1227 of P13009
- E694 (≠ N344) binding
- GDVHD 756:760 (= GDVHD 404:408) binding
- D757 (= D405) mutation to E: Decreases activity by about 70%.; mutation to N: Decreases activity by about 45%.
- H759 (= H407) binding axial binding residue; mutation to G: Loss of catalytic activity.
- S804 (= S452) binding
- T808 (≠ V456) binding
- S810 (= S458) mutation to A: Decreases activity by about 40%.
- A860 (= A508) binding
- D946 (≠ N575) binding
- R1134 (= R752) binding
- YY 1189:1190 (≠ YF 806:807) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 247 binding
- 310 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
- 311 binding ; mutation C->A,S: Loss of zinc binding. Loss of catalytic activity.
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
31% identity, 97% coverage: 23:809/809 of query aligns to 374:1230/1265 of Q99707
- GSR 382:384 (≠ GSK 31:33) binding
- D449 (= D95) binding
- N470 (= N116) binding
- D537 (= D183) binding
- N579 (= N225) binding
- R585 (= R231) binding
- R591 (= R235) binding
- D919 (≠ F518) to G: in dbSNP:rs1805087
- D963 (= D564) mutation to E: Decreases binding to MTRR; when associated with N-1071.
- K1071 (vs. gap) mutation to N: Decreases binding to MTRR; when associated with E-963.
Sites not aligning to the query:
- 61 natural variant: R -> K
- 255 C → Y: in dbSNP:rs1140598
5vooA Methionine synthase folate-binding domain with methyltetrahydrofolate from thermus thermophilus hb8 (see paper)
51% identity, 34% coverage: 21:295/809 of query aligns to 3:280/282 of 5vooA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E7 (= E25), R8 (= R26), G13 (= G31), S14 (= S32), K15 (= K33), D77 (= D95), N98 (= N116), D165 (= D183), G204 (= G222), N207 (= N225), F210 (= F228), R217 (= R235), I237 (= I255)
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
29% identity, 62% coverage: 310:809/809 of query aligns to 9:542/576 of 3ivaA
- active site: D107 (= D405), H109 (= H407), S160 (= S458)
- binding cobalamin: H109 (= H407), G112 (= G410), V116 (= V414), G152 (= G450), L153 (= L451), S154 (= S452), L156 (= L454), I157 (≠ L455), T158 (≠ V456), G183 (= G481), G184 (= G482), Q208 (≠ A506), N209 (≠ D507), T303 (≠ R583), D443 (≠ V712), A486 (≠ G754), G488 (= G756), Y489 (= Y757), H495 (≠ L763), A520 (≠ E787), M521 (= M788), G524 (≠ E791), V527 (≠ T794), S528 (= S795)
- binding s-adenosyl-l-homocysteine: E447 (≠ D716), R484 (= R752), P485 (≠ Y753), Y489 (= Y757), A491 (= A759), Y539 (= Y806)
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
29% identity, 62% coverage: 310:809/809 of query aligns to 9:542/577 of 3bulA
- active site: D107 (= D405), H109 (= H407), S160 (= S458)
- binding cobalamin: H109 (= H407), V116 (= V414), G152 (= G450), L153 (= L451), S154 (= S452), L156 (= L454), I157 (≠ L455), T158 (≠ V456), G183 (= G481), G184 (= G482), Q208 (≠ A506), N209 (≠ D507), A210 (= A508), T213 (≠ G511), M302 (≠ R581), D443 (≠ V712), A486 (≠ G754), P487 (≠ F755), G488 (= G756), Y489 (= Y757), H495 (≠ L763), K498 (≠ H766), M521 (= M788), G524 (≠ E791), V527 (≠ T794), S528 (= S795)
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
36% identity, 33% coverage: 23:286/809 of query aligns to 334:602/611 of 4cczA
- binding (6s)-5,6,7,8-tetrahydrofolate: E336 (= E25), G342 (= G31), R344 (≠ K33), N430 (= N116), M458 (≠ L144), D497 (= D183), G536 (= G222), S538 (= S224), N539 (= N225), F542 (= F228), R545 (= R231), R551 (= R235)
3k13C Structure of the pterin-binding domain metr of 5- methyltetrahydrofolate-homocysteine methyltransferase from bacteroides thetaiotaomicron
33% identity, 34% coverage: 17:292/809 of query aligns to 1:280/287 of 3k13C
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: E9 (= E25), G15 (= G31), R17 (≠ K33), N103 (= N116), D170 (= D183), G209 (= G222), S211 (= S224), N212 (= N225), R218 (= R231), R224 (= R235), I244 (= I255)
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
39% identity, 25% coverage: 310:508/809 of query aligns to 9:210/246 of 1bmtA
- active site: D107 (= D405), H109 (= H407), S160 (= S458)
- binding co-methylcobalamin: E44 (≠ N344), M48 (≠ V348), M51 (= M351), G55 (= G355), L65 (= L365), V68 (= V368), D107 (= D405), V108 (= V406), H109 (= H407), D110 (= D408), I111 (= I409), I115 (≠ L413), G152 (= G450), L153 (= L451), S154 (= S452), L156 (= L454), I157 (≠ L455), T158 (≠ V456), G183 (= G481), G184 (= G482), A185 (= A483), V207 (≠ C505), N209 (≠ D507), A210 (= A508)
2ycjA Methyltransferase bound with methyltetrahydrofolate (see paper)
32% identity, 29% coverage: 21:256/809 of query aligns to 11:237/271 of 2ycjA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M20 (≠ G31), F21 (≠ S32), D84 (= D95), N105 (= N116), D169 (= D183), G205 (= G222), N208 (= N225), Q211 (≠ L230), R216 (= R235), I236 (= I255)
2yciX Methyltransferase native (see paper)
32% identity, 29% coverage: 21:256/809 of query aligns to 11:237/271 of 2yciX
2yckX Methyltransferase bound with tetrahydrofolate (see paper)
32% identity, 29% coverage: 21:256/809 of query aligns to 12:238/272 of 2yckX
- binding (6s)-5,6,7,8-tetrahydrofolate: M21 (≠ G31), F22 (≠ S32), D85 (= D95), N106 (= N116), D170 (= D183), G206 (= G222), N209 (= N225), Q212 (≠ L230), K213 (≠ R231), R217 (= R235), I237 (= I255)
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
35% identity, 20% coverage: 322:486/809 of query aligns to 18:187/215 of 7xcnP
- binding 5-hydroxybenzimidazolylcobamide: D104 (= D405), I105 (≠ V406), H106 (= H407), I108 (= I409), G109 (= G410), V113 (= V414), S150 (≠ L451), S151 (= S452), L153 (= L454), M154 (≠ L455), T155 (≠ V456), M180 (≠ L479), G182 (= G481), G183 (= G482)
Sites not aligning to the query:
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
37% identity, 16% coverage: 351:482/809 of query aligns to 46:174/206 of 4jgiB
- active site: D95 (= D405), H97 (= H407), A148 (≠ S458)
- binding co-methylcobalamin: L63 (≠ V368), D95 (= D405), L96 (≠ V406), H97 (= H407), D98 (= D408), I99 (= I409), G100 (= G410), F104 (≠ V414), G140 (= G450), S142 (= S452), L145 (= L455), G173 (= G481), G174 (= G482)
Sites not aligning to the query:
4o1eA Structure of a methyltransferase component in complex with mthf involved in o-demethylation (see paper)
29% identity, 29% coverage: 21:257/809 of query aligns to 6:232/271 of 4o1eA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E10 (= E25), K11 (≠ R26), I16 (≠ S32), N100 (= N116), D164 (= D183), K211 (= K236), I230 (= I255), D232 (= D257)
Sites not aligning to the query:
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
33% identity, 29% coverage: 21:258/809 of query aligns to 2:230/262 of 4djfA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E6 (= E25), M11 (≠ N30), F12 (≠ G31), D75 (= D95), N96 (= N116), D160 (= D183), S198 (= S224), N199 (= N225), R207 (= R235)
- binding calcium ion: G222 (= G250), D224 (≠ N252)
- binding co-methylcobalamin: V168 (≠ S191), Q202 (≠ F228), N203 (≠ G229)
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
33% identity, 29% coverage: 21:258/809 of query aligns to 2:230/262 of 4djeA
- binding cobalamin: V168 (≠ S191), N203 (≠ G229)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E6 (= E25), M11 (≠ N30), F12 (≠ G31), D75 (= D95), N96 (= N116), D160 (= D183), G196 (= G222), S198 (= S224), N199 (= N225), R207 (= R235)
- binding calcium ion: G222 (= G250), D224 (≠ N252)
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
33% identity, 29% coverage: 21:258/809 of query aligns to 2:230/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
33% identity, 29% coverage: 21:258/809 of query aligns to 2:230/262 of 2e7fA
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: E6 (= E25), M11 (≠ N30), F12 (≠ G31), D75 (= D95), N96 (= N116), D160 (= D183), G196 (= G222), S198 (= S224), N199 (= N225), Q202 (≠ F228), R207 (= R235), I227 (= I255)
- binding calcium ion: G222 (= G250), D224 (≠ N252)
Query Sequence
>WP_072909508.1 NCBI__GCF_900142125.1:WP_072909508.1
MKVSVSSLYQAVELNQEIPPLLIGERCNPNGSKAFREALLAEDWDSCLKMALDQEARGAQ
VLDLCVAYAGRDELSDMNTLVKLFAGSCKAPLMLDSTSPETLSAVLPLYPGRAIINSINL
EDGGANLDKICALAKKYGAAVVALTITEEGMALTCEKKVAAAKEIYRLAVEKHGLRAQDI
LFDLLTFTVGSGDEKMRDAAIQTLDAIKQVKKELPGVGFTLGVSNISFGLRPAARKVLNS
VFLHEAVAAGLNTAIVDAAKVLPYVAISDEDRQLCLDLLFNRSDDALMNFIEHFEQAVEE
SDEEESDTLLEEQLRQKVLKGDKEGLEDLLTELRGRWQPLDIINGLLVPAMREVGELFGR
GELLLPFVLQSAEVMKQSVNLLEPYMEKLSDEGRTSILLATVAGDVHDIGKNLVDIILSN
NGYKVHNIGIKVPAEEIIAKAKELQVDVVGLSGLLVKSALLMKENMLQFQAAGLTQPVLL
GGAALTPKFVAEDCVPGYENQVVYCADAFAGLKAIRDFESGSLQSTRWESAAVAANKPGP
QQEGIDRSQIPPSVPFLGEKIIEDLPAEPLFNYLNQAALFRGRWGYRRGKMSKEEYAELT
DKTVLPLYARLKDQALSENWLQPKVAYGYFDCCSEGDSLLVHSTSGEKRFDFPRQPAPPH
LCIADYFRSAEEGGDKVGFFVVTIGDRLAEMTSELYASDSYHDYLMLHGLGVELTDGLAE
YWHEQMRIEMGLQQQAQADVAAYVAQGYQGSRYGFGYPACPDLEAHLPLFELVKAQQIGV
GLTESFEMVPEMSTSAIVVHHPQAKYFAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory