SitesBLAST
Comparing WP_073036654.1 NCBI__GCF_900129305.1:WP_073036654.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 49% coverage: 5:75/146 of query aligns to 269:342/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 49% coverage: 5:75/146 of query aligns to 269:342/344 of 3tuiC
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 49% coverage: 5:75/146 of query aligns to 268:341/343 of P30750
- VDAPLL 278:283 (≠ VDKPIV 15:20) binding
- N295 (= N32) mutation to A: Reduces the binding of L-methionine to undetectable levels.
- NI 295:296 (= NI 32:33) binding
Sites not aligning to the query:
- 40:46 binding
- 166 E→Q: Exhibits little ATPase activity.
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 47% coverage: 5:72/146 of query aligns to 269:339/344 of 6cvlD
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 12, 14, 19, 41, 42, 43, 44, 45, 46, 47, 141, 143, 146, 200
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
45% identity, 29% coverage: 90:131/146 of query aligns to 143:184/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C95), T150 (= T97), I153 (≠ L100), C169 (= C116), K170 (≠ S117), G171 (≠ A118), H172 (≠ C119), R173 (≠ E120), H174 (≠ L121), C175 (= C122)
- binding protoporphyrin ix containing fe: T150 (= T97), K170 (≠ S117), H172 (≠ C119)
- binding iron/sulfur cluster: C144 (= C91), V162 (= V109), C179 (= C126), A183 (= A130), I184 (≠ M131)
Sites not aligning to the query:
- binding fe3-s4 cluster: 193
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41, 135, 136, 137, 138, 139, 142, 195, 196, 197, 198, 199, 209, 211, 215, 219, 220
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
39% identity, 37% coverage: 78:131/146 of query aligns to 2:55/102 of 8a8oD
- binding iron/sulfur cluster: I2 (= I78), C9 (= C85), I10 (≠ Y86), G11 (≠ Q87), C12 (= C88), G13 (= G89), C15 (= C91), C19 (= C95), P20 (= P96), S32 (≠ A108), C40 (= C116), W41 (≠ S117), D42 (≠ A118), C43 (= C119), A44 (≠ E120), C46 (= C122), C50 (= C126), I55 (≠ M131)
8f61B Dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with dihydrothymine quasi-anaerobically (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 925:1010/1016 of 8f61B
- binding iron/sulfur cluster: A944 (≠ Q76), C951 (= C85), I952 (≠ Y86), N953 (≠ Q87), C954 (= C88), G955 (= G89), C957 (= C91), C961 (= C95), Y966 (≠ A99), I969 (= I102), P978 (≠ L110), C984 (= C116), T985 (≠ S117), G986 (≠ A118), C987 (= C119), T988 (≠ E120), C990 (= C122), C994 (= C126), P995 (= P127), C999 (≠ M131), I1000 (= I132)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 229, 233, 258, 259, 281, 341, 344, 478, 479, 486, 487, 490
- binding flavin mononucleotide: 548, 549, 572, 573, 607, 666, 707, 734, 764, 765, 791, 792, 793, 814, 815
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 93, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154, 488
- binding (5S)-5-methyl-1,3-diazinane-2,4-dione: 607, 609, 734, 735
7m32A Dihydropyrimidine dehydrogenase (dpd) c671a mutant soaked with uracil and NADPH anaerobically (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 919:1004/1011 of 7m32A
- binding iron/sulfur cluster: A938 (≠ Q76), C945 (= C85), I946 (≠ Y86), N947 (≠ Q87), C948 (= C88), G949 (= G89), C951 (= C91), C955 (= C95), I963 (= I102), P972 (≠ L110), C978 (= C116), T979 (≠ S117), G980 (≠ A118), C981 (= C119), T982 (≠ E120), C984 (= C122), C988 (= C126), P989 (= P127), I994 (= I132)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 233, 258, 259, 281, 282, 340, 341, 478, 479, 486, 487, 490
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: 548, 549, 572, 573, 588, 607, 666, 701, 758, 759, 786, 787, 808, 809, 812
- binding leucine: 577, 615
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154
- binding uracil: 607, 609, 728, 729
1h7xA Dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), NADPH and 5-fluorouracil (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 926:1011/1016 of 1h7xA
- binding iron/sulfur cluster: A945 (≠ Q76), C952 (= C85), I953 (≠ Y86), N954 (≠ Q87), C955 (= C88), G956 (= G89), C958 (= C91), C962 (= C95), I970 (= I102), C985 (= C116), T986 (≠ S117), G987 (≠ A118), C988 (= C119), T989 (≠ E120), C991 (= C122), C995 (= C126), P996 (= P127), I1001 (= I132)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 673, 708, 734
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 234, 259, 260, 282, 283, 285, 342, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 708, 765, 766, 792, 793, 794, 815, 816, 819
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 338, 339, 342, 363, 364, 370, 436, 437, 480, 483, 484, 485, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 134, 135, 139, 140, 141, 149, 151, 155
- binding 5-fluorouracil: 608, 610, 735, 736
7m31A Dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with thymine and NADPH anaerobically (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 921:1006/1011 of 7m31A
- binding iron/sulfur cluster: A940 (≠ Q76), C947 (= C85), I948 (≠ Y86), N949 (≠ Q87), C950 (= C88), G951 (= G89), C953 (= C91), C957 (= C95), I965 (= I102), P974 (≠ L110), C980 (= C116), T981 (≠ S117), G982 (≠ A118), C983 (= C119), T984 (≠ E120), C986 (= C122), C990 (= C126), P991 (= P127), C995 (≠ M131), I996 (= I132)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 228, 229, 233, 259, 281, 341, 478, 479, 486, 487, 490
- binding flavin mononucleotide: 548, 549, 572, 573, 588, 607, 666, 703, 760, 761, 787, 788, 789, 810, 811, 814
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 338, 339, 340, 341, 362, 363, 435, 436, 437, 485
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 93, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154
- binding thymine: 607, 610, 730, 731
7ljuA Porcine dihydropyrimidine dehydrogenase (dpd) crosslinked with 5- ethynyluracil (5eu) (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 926:1011/1016 of 7ljuA
- binding iron/sulfur cluster: C952 (= C85), I953 (≠ Y86), N954 (≠ Q87), C955 (= C88), G956 (= G89), K957 (≠ A90), C958 (= C91), C962 (= C95), I970 (= I102), P979 (≠ L110), C985 (= C116), T986 (≠ S117), G987 (≠ A118), C988 (= C119), T989 (≠ E120), C991 (= C122), C995 (= C126), P996 (= P127), C1000 (≠ M131), I1001 (= I132)
Sites not aligning to the query:
- active site: 573, 670, 708
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 230, 234, 260, 282, 342, 479, 480, 487, 488, 491
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: 549, 550, 573, 574, 589, 608, 667, 708, 765, 766, 792, 793, 794, 815, 816, 819
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 339, 340, 341, 342, 363, 364, 370, 436, 437, 438, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 134, 135, 139, 140, 141, 149, 151, 155
- binding 5-ethynylpyrimidine-2,4(1H,3H)-dione: 608, 612, 667, 735, 736
7ljtA Porcine dihydropyrimidine dehydrogenase (dpd) soaked with 5- ethynyluracil (5eu), NADPH - 20 minutes (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 926:1011/1016 of 7ljtA
- binding iron/sulfur cluster: C952 (= C85), I953 (≠ Y86), C955 (= C88), G956 (= G89), C958 (= C91), C962 (= C95), I970 (= I102), P979 (≠ L110), C985 (= C116), T986 (≠ S117), G987 (≠ A118), C988 (= C119), T989 (≠ E120), C991 (= C122), C995 (= C126), P996 (= P127), C1000 (≠ M131), I1001 (= I132)
Sites not aligning to the query:
- active site: 573, 670, 708
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 229, 230, 234, 260, 282, 283, 342, 479, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 608, 667, 708, 735, 765, 766, 792, 793, 794, 815, 816
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 288, 339, 340, 341, 342, 363, 364, 370, 436, 437, 438, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 86, 90, 94, 96, 129, 135, 139, 140, 141, 149, 151, 155
- binding 5-ethynylpyrimidine-2,4(1H,3H)-dione: 608, 611, 612, 667, 735, 736
7ljsA Porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 915:1000/1005 of 7ljsA
- binding iron/sulfur cluster: C941 (= C85), I942 (≠ Y86), C944 (= C88), G945 (= G89), C947 (= C91), C951 (= C95), I959 (= I102), P968 (≠ L110), C974 (= C116), T975 (≠ S117), G976 (≠ A118), C977 (= C119), T978 (≠ E120), C980 (= C122), C984 (= C126), P985 (= P127), C989 (≠ M131)
Sites not aligning to the query:
- active site: 573, 670, 703
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 230, 234, 260, 282, 341, 342, 479, 480, 486, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 608, 667, 703, 760, 761, 787, 788, 789, 810, 811
- binding iron/sulfur cluster: 78, 80, 81, 86, 90, 94, 96, 129, 135, 139, 140, 141, 149, 155
- binding 5-ethynylpyrimidine-2,4(1H,3H)-dione: 608, 611, 612, 730, 731
1gthD Dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with NADPH and 5-iodouracil (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 926:1011/1019 of 1gthD
- binding iron/sulfur cluster: A945 (≠ Q76), I947 (= I78), C952 (= C85), I953 (≠ Y86), N954 (≠ Q87), C955 (= C88), G956 (= G89), K957 (≠ A90), C958 (= C91), C962 (= C95), I970 (= I102), C985 (= C116), T986 (≠ S117), G987 (≠ A118), C988 (= C119), T989 (≠ E120), C991 (= C122), C995 (= C126), P996 (= P127), C1000 (≠ M131), I1001 (= I132)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 673, 708, 734
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 229, 230, 234, 259, 260, 281, 282, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 708, 765, 766, 792, 793, 794, 815, 816, 819
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 130, 338, 339, 340, 341, 342, 363, 364, 370, 436, 437, 438, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 131, 134, 135, 139, 140, 141, 149, 151, 151, 155
- binding uracil: 608, 610, 667, 670, 671, 735, 736
1gthA Dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with NADPH and 5-iodouracil (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 926:1011/1019 of 1gthA
- binding iron/sulfur cluster: I947 (= I78), C952 (= C85), I953 (≠ Y86), N954 (≠ Q87), C955 (= C88), G956 (= G89), C958 (= C91), C962 (= C95), I970 (= I102), P979 (≠ L110), C985 (= C116), T986 (≠ S117), G987 (≠ A118), C988 (= C119), T989 (≠ E120), C991 (= C122), C995 (= C126), P996 (= P127), C1000 (≠ M131), I1001 (= I132)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 673, 708, 734
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 229, 230, 234, 259, 260, 282, 342, 479, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 708, 736, 765, 766, 792, 793, 794, 815, 816, 819
- binding (5s)-5-iododihydro-2,4(1h,3h)-pyrimidinedione: 608, 610, 667, 670, 672, 735, 736
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 130, 339, 340, 341, 342, 363, 364, 370, 436, 437, 438, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 125, 129, 131, 134, 135, 139, 140, 141, 149, 151, 151, 155
1gteA Dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 915:1000/1005 of 1gteA
- binding iron/sulfur cluster: A934 (≠ Q76), I936 (= I78), C941 (= C85), I942 (≠ Y86), N943 (≠ Q87), C944 (= C88), G945 (= G89), K946 (≠ A90), C947 (= C91), C951 (= C95), I959 (= I102), V970 (≠ E112), C974 (= C116), T975 (≠ S117), G976 (≠ A118), C977 (= C119), T978 (≠ E120), C980 (= C122), C984 (= C126), P985 (= P127), I990 (= I132)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 703, 729
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 234, 259, 260, 282, 283, 285, 341, 342, 479, 480, 486, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 703, 730, 760, 761, 787, 788, 789, 810, 811, 814
- binding 5-iodouracil: 608, 611, 612, 667, 730, 731
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 131, 134, 135, 139, 140, 141, 149, 151, 155
1gt8A Dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with NADPH and uracil-4-acetic acid (see paper)
32% identity, 58% coverage: 59:142/146 of query aligns to 924:1009/1017 of 1gt8A
- binding iron/sulfur cluster: C950 (= C85), I951 (≠ Y86), N952 (≠ Q87), C953 (= C88), G954 (= G89), K955 (≠ A90), C956 (= C91), C960 (= C95), A967 (≠ H101), I968 (= I102), P977 (≠ L110), V979 (≠ E112), C983 (= C116), T984 (≠ S117), G985 (≠ A118), C986 (= C119), T987 (≠ E120), C989 (= C122), C993 (= C126), P994 (= P127), I999 (= I132)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 673, 706, 732
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 229, 230, 234, 259, 260, 282, 342, 479, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 608, 667, 706, 734, 763, 764, 790, 791, 813, 814
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 130, 339, 340, 341, 342, 363, 370, 436, 437, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 134, 135, 139, 140, 149, 151, 155, 489
- binding uracil-6-acetic acid: 608, 610, 611, 612, 733, 761
Q28943 Dihydropyrimidine dehydrogenase [NADP(+)]; DHPDHase; DPD; Dihydrothymine dehydrogenase; Dihydrouracil dehydrogenase; EC 1.3.1.2 from Sus scrofa (Pig) (see 3 papers)
32% identity, 58% coverage: 59:142/146 of query aligns to 927:1012/1025 of Q28943
Sites not aligning to the query:
- 126 C→A: No effect on enzyme activity. Reduced iron content.
- 129 binding
- 156 Q→E: Loss of enzyme activity. Reduces iron content.
- 194:198 binding
- 218:226 binding
- 235 binding ; mutation R->A,K: Loss of enzyme activity. Loss of FAD binding.
- 261 binding
- 340:343 binding
- 364:365 binding
- 371 binding
- 437:439 binding
- 480:489 binding
- 481:487 binding
- 550 binding
- 574:575 binding
- 670 S→A: Strongly reduced affinity for uracil. Reduces enzyme activity by 30%.
- 671 active site, Proton acceptor; C→A: Reduces catalytic activity by 99%.
- 709 binding
- 767 binding
- 793:795 binding
- 816:817 binding
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
31% identity, 49% coverage: 74:145/146 of query aligns to 182:269/348 of 5t61L
- binding iron/sulfur cluster: I186 (= I78), C193 (= C85), H195 (≠ Q87), C196 (= C88), G197 (= G89), C199 (= C91), C203 (= C95), P204 (= P96), I208 (≠ L100), C212 (vs. gap), C215 (vs. gap), C238 (= C116), V239 (≠ S117), N240 (≠ A118), C241 (= C119), G242 (≠ E120), C244 (= C122), C248 (= C126), P249 (= P127)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 146, 153, 156, 159, 163, 164, 168, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
3egwB The crystal structure of the narghi mutant narh - c16a
23% identity, 53% coverage: 58:135/146 of query aligns to 139:236/509 of 3egwB
- binding fe3-s4 cluster: P181 (vs. gap), C196 (= C95), S198 (≠ T97), I201 (≠ L100), C217 (= C116), R218 (≠ S117), G219 (≠ A118), W220 (≠ C119), R221 (≠ E120), C223 (= C122)
- binding protoporphyrin ix containing fe: W220 (≠ C119), R221 (≠ E120)
- binding iron/sulfur cluster: C184 (= C85), E185 (≠ Y86), H186 (≠ Q87), C187 (= C88), P190 (≠ G89), C192 (= C91), C227 (= C126), I232 (≠ M131)
Sites not aligning to the query:
- binding fe3-s4 cluster: 17, 18, 19, 20, 22, 241, 263, 265, 268
- binding protoporphyrin ix containing fe: 88, 89
- binding iron/sulfur cluster: 26, 30, 41, 42, 243, 244, 246, 247, 257, 259
Query Sequence
>WP_073036654.1 NCBI__GCF_900129305.1:WP_073036654.1
MFARMLVLRFPKEVVDKPIVTNLVRNYNLSFNILKAQIFPRKEGLMVLELRGNRKDYEKG
LKYLKDIGVKVESIAQGIRRDEDKCYQCGACTAVCPTGALHIRRPEMAVLFESERCSACE
LCVKTCPARAMIVMFDRKVELEEDVA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory