Comparing WP_073039302.1 NCBI__GCF_900129305.1:WP_073039302.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
52% identity, 96% coverage: 12:392/397 of query aligns to 4:376/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
52% identity, 96% coverage: 12:392/397 of query aligns to 3:375/375 of 2eh6A
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
47% identity, 98% coverage: 2:392/397 of query aligns to 59:453/457 of Q9M8M7
Sites not aligning to the query:
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
47% identity, 96% coverage: 12:393/397 of query aligns to 11:391/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
47% identity, 96% coverage: 12:393/397 of query aligns to 3:383/385 of Q9X2A5
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
46% identity, 96% coverage: 16:395/397 of query aligns to 16:398/401 of 4adbB
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
46% identity, 96% coverage: 16:395/397 of query aligns to 16:398/400 of 4addA
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
44% identity, 95% coverage: 9:386/397 of query aligns to 9:389/402 of 4jevB
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 95% coverage: 9:386/397 of query aligns to 14:394/405 of P40732
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
43% identity, 96% coverage: 15:395/397 of query aligns to 7:388/388 of 3nx3A
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
43% identity, 95% coverage: 9:386/397 of query aligns to 9:384/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
43% identity, 95% coverage: 9:386/397 of query aligns to 3:378/389 of 2pb0A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
44% identity, 95% coverage: 5:381/397 of query aligns to 3:378/390 of 8ht4B
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
41% identity, 98% coverage: 4:392/397 of query aligns to 12:394/395 of Q5SHH5
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
41% identity, 98% coverage: 4:392/397 of query aligns to 4:386/387 of 1wkhA
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
41% identity, 98% coverage: 4:392/397 of query aligns to 4:386/387 of 1wkgA
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
41% identity, 98% coverage: 4:392/397 of query aligns to 4:386/387 of 1vefA
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 98% coverage: 9:397/397 of query aligns to 8:388/390 of A0QYS9
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
41% identity, 97% coverage: 9:392/397 of query aligns to 16:393/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
41% identity, 97% coverage: 9:392/397 of query aligns to 10:387/391 of 7nncC
>WP_073039302.1 NCBI__GCF_900129305.1:WP_073039302.1
MNELMEVCEKVVCNTYARYPVAFERGAGCRLWDTEGKEYMDFLAGIAVCNLGHSHPEVAR
VVCEQARKLVHVSNLFYTRPQVELAARLIERSFADKVFFANSGAEANEAAIKLARKYSRD
KYGPGRFHIITMKDSFHGRTLATLSATGQEKVHKGFDPLVEGFRFVPYNSIQAVEEAVTE
KTCAVLVEPIQGEGGVRPGDPDYFRALRELCTAKDLLLIFDEVQTGMGRTGSLFAYEQLG
VTPDVMTLAKALGNGLPIGAMLATEEAARAFTPGSHASTFGGTPLVTAASAKVLEIISKE
DFLADVREKGRYFLGRLQDLQKKHPDKILDARGRGLMLGLELSRPGKTVVDRCLEQGFVI
NCTHDTVLRFVPPLIVTREEIDRLMETLDAVLKEWEE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory