SitesBLAST
Comparing WP_073040125.1 NCBI__GCF_900129305.1:WP_073040125.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 83% coverage: 28:439/499 of query aligns to 91:488/526 of Q9S7B5
- N172 (≠ P110) binding
- L173 (≠ V111) binding
- K181 (≠ R119) binding in monomer B; binding in monomer A
- N187 (≠ R124) binding in monomer B
- L205 (≠ R142) mutation to R: In mto2-1; causes a strong decrease in the concentration of soluble threonine and over-accumulation of methionine.
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
32% identity, 83% coverage: 28:439/499 of query aligns to 16:413/444 of 2c2bA
- binding pyridoxal-5'-phosphate: F127 (= F139), K128 (= K140), D159 (= D172), G259 (≠ I275), G260 (= G276), N261 (= N277), L262 (≠ A278), G263 (= G279), N264 (= N280), A321 (= A340), H369 (≠ Q395), T397 (= T423)
- binding s-adenosylmethionine: S64 (≠ T77), T65 (= T78), W66 (≠ E79), P67 (= P80), G69 (≠ L82), S90 (≠ Y103), F92 (≠ G105), N97 (≠ P110), L98 (≠ V111), W100 (≠ Q113), W115 (≠ F127), W115 (≠ F127), Q246 (≠ A261), F247 (= F262)
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
31% identity, 83% coverage: 28:439/499 of query aligns to 34:415/448 of 2c2gA
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
34% identity, 67% coverage: 96:428/499 of query aligns to 13:322/350 of 2zsjA
- active site: K61 (= K140), T85 (= T170), Q218 (= Q307), A222 (= A311), A240 (= A340), T317 (= T423)
- binding pyridoxal-5'-phosphate: F60 (= F139), K61 (= K140), N87 (≠ D172), V186 (≠ I275), G187 (= G276), N188 (= N277), A189 (= A278), G190 (= G279), N191 (= N280), A240 (= A340), T317 (= T423), G318 (≠ A424)
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
34% identity, 66% coverage: 102:428/499 of query aligns to 23:322/349 of 2d1fA
- active site: K60 (= K140), T84 (= T170), D209 (≠ T298), R213 (≠ W302), L215 (= L304), A240 (= A340), T317 (= T423)
- binding pyridoxal-5'-phosphate: F59 (= F139), K60 (= K140), N86 (≠ D172), V186 (≠ I275), G187 (= G276), N188 (= N277), A189 (= A278), G190 (= G279), N191 (= N280), A240 (= A340), T317 (= T423)
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 66% coverage: 102:428/499 of query aligns to 32:331/360 of P9WG59
- K69 (= K140) modified: N6-(pyridoxal phosphate)lysine
- N95 (≠ D172) binding
- K151 (≠ Y230) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- GNAGN 196:200 (= GNAGN 276:280) binding
- T326 (= T423) binding
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 66% coverage: 102:428/499 of query aligns to 32:331/360 of A0R220
- K151 (≠ Y230) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
32% identity, 69% coverage: 85:428/499 of query aligns to 5:318/345 of 6cgqB
- active site: K58 (= K140), T82 (= T170), E214 (≠ Q307), S218 (≠ A311), A236 (= A340), T313 (= T423)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-alanine: K58 (= K140), S81 (= S169), T82 (= T170), N84 (≠ D172), T85 (= T173), V183 (≠ I275), G184 (= G276), N185 (= N277), A186 (= A278), N188 (= N280), A236 (= A340), I237 (≠ A341), E283 (≠ Q395), T313 (= T423)
- binding phosphate ion: K58 (= K140), T85 (= T173), N151 (= N241), S152 (= S242), R157 (= R247), N185 (= N277)
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
32% identity, 69% coverage: 85:428/499 of query aligns to 7:320/350 of 6nmxA
- active site: K60 (= K140), T84 (= T170), E216 (≠ Q307), S220 (≠ A311), A238 (= A340), T315 (= T423)
- binding (2E,3Z)-2-{[(Z)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4(1H)-ylidene}methyl]imino}-5-phosphonopent-3-enoic acid: K60 (= K140), S83 (= S169), T84 (= T170), N86 (≠ D172), T87 (= T173), F133 (= F221), N153 (= N241), S154 (= S242), R159 (= R247), V185 (≠ I275), G186 (= G276), N187 (= N277), A188 (= A278), G189 (= G279), N190 (= N280), A238 (= A340), I239 (≠ A341), E285 (≠ Q395), T315 (= T423)
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
33% identity, 71% coverage: 85:438/499 of query aligns to 5:331/350 of 3aeyA
- active site: K60 (= K140), T84 (= T170), P211 (= P301), G215 (= G305), Q217 (= Q307), A239 (= A340), T316 (= T423)
- binding sulfate ion: K60 (= K140), K60 (= K140), G85 (= G171), N86 (≠ D172), T87 (= T173), T87 (= T173), S154 (= S242), R159 (= R247), N187 (= N277), R228 (≠ Q329), V230 (= V331), E231 (≠ T332), R232 (≠ V333), A239 (= A340)
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
33% identity, 71% coverage: 85:438/499 of query aligns to 6:332/351 of 3aexA
- active site: K61 (= K140), T85 (= T170), P212 (= P301), G216 (= G305), Q218 (= Q307), A240 (= A340), T317 (= T423)
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: K61 (= K140), S84 (= S169), T85 (= T170), N87 (≠ D172), T88 (= T173), V186 (≠ I275), G187 (= G276), N188 (= N277), A189 (= A278), G190 (= G279), N191 (= N280), A240 (= A340), I241 (≠ A341), E287 (≠ T394), T317 (= T423)
- binding phosphate ion: K61 (= K140), T88 (= T173), N154 (= N241), S155 (= S242), R160 (= R247), N188 (= N277)
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
33% identity, 71% coverage: 85:438/499 of query aligns to 6:332/351 of 1v7cA
- active site: K61 (= K140), T85 (= T170), P212 (= P301), G216 (= G305), Q218 (= Q307), A240 (= A340), T317 (= T423)
- binding (2e)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]-5-phosphonopent-2-enoic acid: K61 (= K140), S84 (= S169), T85 (= T170), N87 (≠ D172), T88 (= T173), F134 (= F221), N154 (= N241), S155 (= S242), R160 (= R247), V186 (≠ I275), G187 (= G276), N188 (= N277), A189 (= A278), G190 (= G279), N191 (= N280), A240 (= A340), I241 (≠ A341), E287 (≠ T394), T317 (= T423)
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
33% identity, 71% coverage: 85:438/499 of query aligns to 6:332/350 of 1uimA
- active site: K61 (= K140), T85 (= T170), P212 (= P301), G216 (= G305), Q218 (= Q307), A240 (= A340), T317 (= T423)
- binding pyridoxal-5'-phosphate: F60 (= F139), K61 (= K140), N87 (≠ D172), G187 (= G276), N188 (= N277), A189 (= A278), G190 (= G279), N191 (= N280), A240 (= A340), E287 (≠ T394), T317 (= T423), G318 (≠ A424)
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
32% identity, 69% coverage: 85:428/499 of query aligns to 3:310/339 of 6cgqA
- active site: K56 (= K140), T80 (= T170), E206 (≠ Q307), S210 (≠ A311), A228 (= A340), T305 (= T423)
- binding pyridoxal-5'-phosphate: F55 (= F139), K56 (= K140), N82 (≠ D172), V175 (≠ I275), G176 (= G276), N177 (= N277), A178 (= A278), G179 (= G279), N180 (= N280), A228 (= A340), E275 (≠ Q395), T305 (= T423), G306 (≠ A424)
1vb3A Crystal structure of threonine synthase from escherichia coli
29% identity, 59% coverage: 135:429/499 of query aligns to 102:382/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
30% identity, 30% coverage: 133:283/499 of query aligns to 106:263/464 of 4f4fA
Sites not aligning to the query:
1kl7A Crystal structure of threonine synthase from yeast (see paper)
28% identity, 30% coverage: 135:283/499 of query aligns to 118:281/509 of 1kl7A
Sites not aligning to the query:
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 30% coverage: 135:283/499 of query aligns to 112:277/514 of Q42598
Sites not aligning to the query:
- 319 modified: Phosphoserine
- 321 modified: Phosphoserine
Query Sequence
>WP_073040125.1 NCBI__GCF_900129305.1:WP_073040125.1
MKWTDFPESIRSYVLPETAGRYVYRCLGCRATFGVEKLLYTCPECASVLMIQDEDWDRLK
AVSGPTWRRIFDYRAMTTEPALKGIYRFHELLGSILPLDAVIYLGEGHTPVVQANGRMRD
WTGRPFFFKNDGQNPSASFKDRGMASAFSYLNYLIKTQKLSQVLAVCASTGDTSAAAALY
ASYLVDGVTSAVLLPHGKVTPQQLSQPLGSGARVIEIPGVFDDCMKIVEYLAERYPVALM
NSKNAWRILGQESYSYEIAQAFDYDVSDLVVTVPIGNAGNITAVMAGFLKLHDLGIITQL
PWILGVQSHHADPVYRYYLESDPQKRVFQPVTVQPSVAQAAMIGNPVSMPRVMQLVEQFR
SIGGEKAVQVVQVTEQEIMDAMLLANRNGHIACTQGGECLAGFRRAVSDGNIPDGKVGVL
DATAHALKFAVFQEKYFEDRFEPEFGVVPKEELRNRPVLVRPPQGVPCPVPGTAMDPQSF
RSFVTATGDAVAELLGLRR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory