SitesBLAST
Comparing WP_073040765.1 NCBI__GCF_900129305.1:WP_073040765.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
45% identity, 78% coverage: 2:412/526 of query aligns to 8:418/533 of O43175
- T78 (= T73) binding
- R135 (≠ K130) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 150:151) binding
- D175 (= D170) binding
- T207 (= T202) binding
- CAR 234:236 (= CAR 229:231) binding
- D260 (= D255) binding
- V261 (= V256) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 278:281) binding
- A373 (≠ S368) to T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- G377 (= G372) to S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
38% identity, 100% coverage: 3:526/526 of query aligns to 4:525/526 of 3dc2A
- active site: N96 (= N97), R230 (= R231), D254 (= D255), E259 (= E260), H277 (= H278)
- binding serine: Y458 (≠ N459), D460 (= D461), R461 (≠ K462), P462 (= P463), G463 (= G464), A464 (≠ V465), L465 (≠ I466), L484 (= L485)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
38% identity, 100% coverage: 3:526/526 of query aligns to 5:524/525 of 3ddnB
7dkmA Phgdh covalently linked to oridonin (see paper)
52% identity, 57% coverage: 2:303/526 of query aligns to 4:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T73), A102 (= A101), G148 (= G147), R151 (≠ K150), I152 (= I151), Y170 (= Y169), D171 (= D170), P172 (= P171), I173 (≠ H172), H202 (= H201), T203 (= T202), P204 (= P203), T209 (= T208), C230 (= C229), A231 (= A230), R232 (= R231), H279 (= H278), G281 (= G280)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ K12), K17 (≠ D15), I18 (≠ L16), E293 (≠ R292)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
52% identity, 57% coverage: 2:303/526 of query aligns to 3:303/303 of 6plgA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
52% identity, 57% coverage: 2:303/526 of query aligns to 4:304/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
52% identity, 57% coverage: 2:302/526 of query aligns to 3:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ I146), G147 (= G147), L148 (= L148), G149 (= G149), R150 (≠ K150), I151 (= I151), G152 (= G152), D170 (= D170), H201 (= H201), T202 (= T202), P203 (= P203)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
52% identity, 57% coverage: 2:302/526 of query aligns to 3:302/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
52% identity, 57% coverage: 2:300/526 of query aligns to 2:299/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N97), A100 (= A101), R149 (≠ K150), I150 (= I151), Y168 (= Y169), D169 (= D170), P170 (= P171), I171 (≠ H172), H200 (= H201), T201 (= T202), P202 (= P203), T207 (= T208), C228 (= C229), A229 (= A230), R230 (= R231), H277 (= H278), G279 (= G280)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
52% identity, 57% coverage: 2:300/526 of query aligns to 3:300/301 of 6rj5A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
52% identity, 57% coverage: 3:302/526 of query aligns to 1:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G149), I148 (= I151), Y166 (= Y169), D167 (= D170), P168 (= P171), I169 (≠ H172), I170 (= I173), H198 (= H201), T199 (= T202), L208 (≠ I211), R228 (= R231)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
52% identity, 56% coverage: 2:298/526 of query aligns to 2:297/297 of 6rj3A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
51% identity, 57% coverage: 2:300/526 of query aligns to 2:291/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K150), Y160 (= Y169), D161 (= D170), P162 (= P171), I164 (= I173), L179 (= L188), T193 (= T202), P194 (= P203), S198 (≠ D207), L202 (≠ I211)
7cvpA The crystal structure of human phgdh from biortus.
51% identity, 49% coverage: 42:300/526 of query aligns to 21:254/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G147), G103 (= G149), R104 (≠ K150), I105 (= I151), Y123 (= Y169), D124 (= D170), P125 (= P171), I126 (≠ H172), H155 (= H201), T156 (= T202), P157 (= P203), T162 (= T208), C183 (= C229), A184 (= A230), R185 (= R231), H232 (= H278), G234 (= G280)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
44% identity, 58% coverage: 1:303/526 of query aligns to 1:303/304 of 1wwkA
- active site: S96 (≠ N97), R230 (= R231), D254 (= D255), E259 (= E260), H278 (= H278)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A101), G146 (= G147), F147 (≠ L148), G148 (= G149), R149 (≠ K150), I150 (= I151), Y168 (= Y169), D169 (= D170), P170 (= P171), V201 (≠ T202), P202 (= P203), T207 (= T208), T228 (≠ C229), S229 (≠ A230), D254 (= D255), H278 (= H278), G280 (= G280)
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
53% identity, 39% coverage: 97:299/526 of query aligns to 2:204/204 of 6rj6A
- binding 2-[4-[(1~{S})-1-[[4,5-bis(chloranyl)-1,6-dimethyl-indol-2-yl]carbonylamino]-2-oxidanyl-ethyl]phenyl]sulfonylethanoic acid: G52 (= G147), R55 (≠ K150), I56 (= I151), Y74 (= Y169), D75 (= D170), P76 (= P171), I77 (≠ H172), I78 (= I173), H106 (= H201), T107 (= T202), P108 (= P203), T113 (= T208)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
39% identity, 58% coverage: 2:307/526 of query aligns to 4:316/334 of 5aovA
- active site: L100 (≠ N97), R241 (= R231), D265 (= D255), E270 (= E260), H288 (= H278)
- binding glyoxylic acid: M52 (≠ R49), L53 (≠ S50), L53 (≠ S50), Y74 (≠ A71), A75 (≠ G72), V76 (≠ T73), G77 (= G74), R241 (= R231), H288 (= H278)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T73), T104 (≠ A101), F158 (≠ L148), G159 (= G149), R160 (≠ K150), I161 (= I151), S180 (≠ D170), R181 (≠ P171), A211 (≠ H201), V212 (≠ T202), P213 (= P203), T218 (= T208), I239 (≠ C229), A240 (= A230), R241 (= R231), H288 (= H278), G290 (= G280)
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
55% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofwA
- active site: N3 (= N97), R137 (= R231), D161 (= D255), E166 (= E260), H184 (= H278)
- binding 3-chloranyl-4-fluoranyl-benzamide: G53 (= G147), Y75 (= Y169), P77 (= P171), T108 (= T202), S113 (≠ D207), T114 (= T208), L117 (≠ I211)
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
55% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofvA
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
55% identity, 37% coverage: 96:287/526 of query aligns to 2:193/195 of 5ofmA
Query Sequence
>WP_073040765.1 NCBI__GCF_900129305.1:WP_073040765.1
MKILICDGMHPKGLDLLRAEDDLEVLAPDQPGPEEVRELAADCDALVVRSRTKVTEDLIS
AAPRLKVIGRAGTGVDNIDIAAASARGILVMNTPGANAMAAAEHTMALMLALARHVPQAT
QSLRDGRWEKKRFMGTELYQQTLGIIGLGKIGAIVADRALGMKMNVLVYDPHITPETAAI
MGTEWVPLEELFQRSDFITLHTPLTPDTRNIINRDSIALMKKGVRIINCARGGLVDEEAL
YEALVSGHVAGAALDVFAKEPPEGNPLLRLENVIFTPHLGASSFQAQENVARAIASQIVD
YLKRGIIRNAVNFPSISPRDYERIKPYLTLAERLGHLQGQLCSPIERVEIEYSGPELTEL
PLDPLTQSIAKGLLDPILAEKVNLVNAPMLLKERKIQLVATTTSEARGYTGLIRVTVEGK
GRKRSATGAVFPGNEIRLVRMNTYRLEAELEGINLIVQNVDKPGVIGFIGTTLGTHQVNI
ANMHLSRTPEKDRAIAIIRLDGEAPPEALDALRSNPDILSVEQVWL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory