SitesBLAST
Comparing WP_073040986.1 NCBI__GCF_900129305.1:WP_073040986.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
42% identity, 39% coverage: 7:271/680 of query aligns to 3:268/281 of 6aa8E
- active site: S116 (= S120), H137 (= H141), E149 (= E153), N187 (= N191)
- binding nicotinamide-adenine-dinucleotide: I6 (≠ V10), G9 (= G13), T10 (= T14), M11 (= M15), R29 (≠ V33), D30 (= D34), I31 (≠ V35), A86 (= A90), A87 (≠ V91), E89 (= E93), K94 (= K98), N114 (= N118), S116 (= S120)
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
38% identity, 39% coverage: 9:271/680 of query aligns to 6:269/282 of 4kugA
- active site: S117 (= S120), H138 (= H141), E150 (= E153), N188 (= N191)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), T11 (= T14), M12 (= M15), R30 (≠ V33), D31 (= D34), A87 (= A90), A88 (≠ V91), E90 (= E93), N115 (= N118), S117 (= S120), H138 (= H141)
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
38% identity, 39% coverage: 9:271/680 of query aligns to 6:269/280 of 4kuhA
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
30% identity, 54% coverage: 7:370/680 of query aligns to 364:761/763 of P40939
- E510 (= E153) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
Sites not aligning to the query:
- 282 V → D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- 305 I → N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- 342 L → P: in LCHAD deficiency; dbSNP:rs137852772
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
37% identity, 39% coverage: 6:271/680 of query aligns to 4:270/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
37% identity, 39% coverage: 6:271/680 of query aligns to 4:270/283 of 4pzdA
- active site: S118 (= S120), H139 (= H141), E151 (= E153), N189 (= N191)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), T12 (= T14), M13 (= M15), D32 (= D34), A88 (= A90), A89 (≠ V91), T90 (≠ F92), E91 (= E93), I99 (≠ L101), N116 (= N118), S118 (= S120), N142 (≠ Y144)
9jheA 3-hydroxybutyryl-coa dehydrogenase with NAD (see paper)
37% identity, 39% coverage: 5:271/680 of query aligns to 1:267/289 of 9jheA
- binding nicotinamide-adenine-dinucleotide: I6 (≠ V10), G7 (= G11), G9 (= G13), T10 (= T14), M11 (= M15), D31 (= D34), I32 (≠ V35), K74 (≠ D77), A87 (= A90), A88 (≠ V91), F89 (= F92), E90 (= E93), N115 (= N118), S117 (= S120), H136 (= H141)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
38% identity, 34% coverage: 7:238/680 of query aligns to 30:267/314 of P00348
- GGGLMG 34:39 (≠ GAGTMG 11:16) binding NAD(+)
- D57 (= D34) binding NAD(+)
- E122 (= E93) binding NAD(+)
- K127 (= K98) binding NAD(+)
- S149 (= S120) binding NAD(+)
9jhyB 3-hydroxybutyryl-coa dehydrogenase mutant (s117a) with acetoacetyl coa (see paper)
36% identity, 39% coverage: 5:271/680 of query aligns to 1:263/285 of 9jhyB
- binding acetoacetyl-coenzyme a: L51 (≠ A54), K54 (≠ R57), K56 (≠ I59), I57 (≠ F60), H132 (= H141), F134 (= F143), N135 (≠ Y144), R139 (≠ K148), N182 (= N191), L185 (≠ F194), M218 (= M227), I227 (≠ T236)
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
38% identity, 34% coverage: 7:238/680 of query aligns to 7:244/293 of 1f17A
- active site: S126 (= S120), H147 (= H141), E159 (= E153), N197 (= N191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L14 (≠ T14), M15 (= M15), D34 (= D34), Q35 (≠ V35), A96 (= A90), I97 (≠ V91), E99 (= E93), K104 (= K98), N124 (= N118), S126 (= S120), H147 (= H141)
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
38% identity, 34% coverage: 7:238/680 of query aligns to 7:244/293 of 1f12A
- active site: S126 (= S120), H147 (= H141), E159 (= E153), N197 (= N191)
- binding 3-hydroxybutanoyl-coenzyme a: K57 (≠ R57), S126 (= S120), H147 (= H141), F149 (= F143), N150 (≠ Y144), M155 (≠ N149), N197 (= N191), L200 (≠ F194), P232 (≠ G226), M233 (= M227), L238 (= L232)
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
38% identity, 34% coverage: 7:238/680 of query aligns to 7:244/291 of 1f0yA
- active site: S126 (= S120), H147 (= H141), E159 (= E153), N197 (= N191)
- binding acetoacetyl-coenzyme a: S50 (≠ T50), K57 (≠ R57), S126 (= S120), H147 (= H141), F149 (= F143), N150 (≠ Y144), P151 (≠ H145), P153 (≠ A147), V154 (≠ K148), N197 (= N191), P232 (≠ G226), M233 (= M227), L238 (= L232)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L14 (≠ T14), M15 (= M15), D34 (= D34), Q35 (≠ V35), A96 (= A90), I97 (≠ V91), E99 (= E93), K104 (= K98), N124 (= N118), S126 (= S120), H147 (= H141), N150 (≠ Y144), V242 (≠ T236)
Sites not aligning to the query:
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
38% identity, 34% coverage: 7:238/680 of query aligns to 30:267/314 of Q16836
- GGGLMG 34:39 (≠ GAGTMG 11:16) binding NAD(+)
- A40 (≠ S17) to T: in HADH deficiency; dbSNP:rs137853101
- D57 (= D34) binding NAD(+); to E: in HADH deficiency; dbSNP:rs137853102; to G: found in a patient with Reye-like syndrome; does not affect 3-hydroxyacyl-CoA dehydrogenase activity; increases KM value for NADH; does not affect dimerization
- S73 (≠ T50) binding CoA
- K80 (≠ R57) binding CoA
- L86 (≠ G63) to P: in dbSNP:rs4956145
- E122 (= E93) binding NAD(+)
- K127 (= K98) binding NAD(+); modified: N6-(2-hydroxyisobutyryl)lysine
- S149 (= S120) binding CoA; binding NAD(+)
- Q152 (≠ Y123) to H: in dbSNP:rs1051519
- N173 (≠ Y144) binding NAD(+)
- Y226 (≠ L197) to H: found in a patient with Reye-like syndrome; loss of 3-hydroxyacyl-CoA dehydrogenase activity. Does not affect dimerization; dbSNP:rs146036912
- P258 (= P229) to L: in HHF4; loss of 3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137853103
Sites not aligning to the query:
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
30% identity, 51% coverage: 24:368/680 of query aligns to 326:702/707 of 6yswA
Sites not aligning to the query:
- active site: 66, 71, 84, 88, 112, 115, 136, 137, 145, 264
- binding coenzyme a: 23, 25, 66, 67, 68, 136, 137, 140, 290, 293
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
35% identity, 36% coverage: 368:615/680 of query aligns to 1:252/259 of 5zaiC
- active site: A65 (= A432), F70 (= F437), S82 (≠ T453), R86 (≠ H457), G110 (= G481), E113 (= E484), P132 (= P503), E133 (= E504), I138 (= I509), P140 (= P511), G141 (= G512), A226 (≠ N595), F236 (vs. gap)
- binding coenzyme a: K24 (≠ A391), L25 (= L392), A63 (= A430), G64 (= G431), A65 (= A432), D66 (= D433), I67 (= I434), P132 (= P503), R166 (≠ T537), F248 (≠ E611), K251 (≠ E614)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
34% identity, 34% coverage: 7:237/680 of query aligns to 294:522/692 of 6iunB
- active site: S407 (= S120), H428 (= H141), E440 (= E153), N478 (= N191)
- binding nicotinamide-adenine-dinucleotide: G300 (= G13), T301 (= T14), M302 (= M15), E321 (≠ D34), T322 (≠ V35), Y365 (≠ K78), A377 (= A90), V378 (= V91), E380 (= E93), V384 (= V97), V388 (≠ L101), N405 (= N118), S407 (= S120)
Sites not aligning to the query:
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
35% identity, 34% coverage: 6:238/680 of query aligns to 303:531/725 of 5omoA
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 25, 26, 28, 31, 64, 66, 67, 68, 103, 105, 108, 127, 128, 161, 260, 280
- binding 3-keto-decanoyl-coa: 658
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
35% identity, 34% coverage: 6:238/680 of query aligns to 303:531/725 of 5mgbA
- active site: S415 (= S120), H436 (= H141), E448 (= E153), N486 (= N191)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ V10), G308 (= G11), G310 (= G13), T311 (= T14), M312 (= M15), E331 (≠ D34), S332 (≠ V35), Q336 (≠ F39), V386 (= V91), F387 (= F92), E388 (= E93), N413 (= N118), S415 (= S120), H436 (= H141)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding acetoacetyl-coenzyme a: 25, 26, 64, 65, 66, 67, 68, 105, 128, 161
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
35% identity, 34% coverage: 6:238/680 of query aligns to 303:531/725 of 3zwcA
- active site: S415 (= S120), H436 (= H141), E448 (= E153), N486 (= N191)
- binding nicotinamide-adenine-dinucleotide: G308 (= G11), G310 (= G13), T311 (= T14), M312 (= M15), E331 (≠ D34), Q336 (≠ F39), A385 (= A90), V386 (= V91), F387 (= F92), E388 (= E93), K393 (= K98), N413 (= N118), S415 (= S120), H436 (= H141)
Sites not aligning to the query:
- active site: 66, 71, 81, 105, 108, 127, 128, 135, 136, 254
- binding (s)-3-hydroxydecanoyl-coa: 26, 64, 65, 66, 67, 68, 77, 78, 80, 101, 104, 105, 108, 128, 260
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
35% identity, 34% coverage: 6:238/680 of query aligns to 303:531/725 of 3zwbA
Sites not aligning to the query:
- active site: 66, 81, 105, 108, 127, 128, 135, 136
- binding (2E)-Hexenoyl-CoA: 25, 26, 28, 64, 65, 66, 67, 68, 101, 103, 105, 108, 136, 161, 280
Query Sequence
>WP_073040986.1 NCBI__GCF_900129305.1:WP_073040986.1
MHGAMTIGVVGAGTMGSGIAQKLAQEGFRVVLVDVESRFVERGIGLIQSTLREAVKRKIF
DEGRVAEILGRIHGTVDKSALKNADLVIEAVFEDEQVKKDLFRELDAICAPQTIFATNTS
SFYVKDMAAVTSRPDRFVGMHYFYHPAKNRLLEVIPHEGTSRETLQKAVEIGRLHGKVVI
VVKDVSGFAVNRFFSPLLTEAVQVLSEGWANIPTIEKAAKEAFGIGMGPFELMNVTGIPI
AVHASTTFGRELGSLYGTPKLLRDQFESGELWDLEGDVDDTKIEAVQDRLYGACLGAAAA
LVSEGVASIEDTDRGAKVGLRWSRGPFEIMNDIGIDRAYRLVHAMTERYRDFAMPEILVR
QRANGEPFRFRYVDYEVEGEVAYITINRPEALNALNEATVSQLAESFDQAEKDPGVNAVV
IRGAGKAFVAGADIRFFIRKIQEGRIEDIVSFTRAGHDLLLRLENSPKLTIAQLDGLSMG
GGSELALACQAVVATPAASMSFPETGIGIYPGLGGMIRTARRIGLELAKYYVFTGETISA
QDALDLGLVSKLVPPHQVNESIRELISAGRPKDKYAKRDLPKRFQERARLCSAENVQRIL
QGDRPEGVSAELAERFMGRIARKAPLAVQKANELMDAQMGVEIPKAIEMELEALPYMFGT
KDALIGLSSVGAAPPRFLGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory