Comparing WP_073041573.1 NCBI__GCF_900129305.1:WP_073041573.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
43% identity, 77% coverage: 41:207/218 of query aligns to 42:203/506 of A0A0H2ZQB9
Sites not aligning to the query:
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
36% identity, 91% coverage: 1:199/218 of query aligns to 36:233/553 of B5Z7I3
Sites not aligning to the query:
>WP_073041573.1 NCBI__GCF_900129305.1:WP_073041573.1
MSVWEFFVNNWQETLHLATQHFTFVTIAVLIAIVTGVPIGIWISFNRKAAEVVLYLAGII
MTIPSIALFGIMIPILSVFGYGIGTVPAVVALVLYSQLPIIRNTYAALNAVDPAIIDAGT
GMGMTRRQVLFKVQIPMALSVIFAGVRVAVVMSIGIGAIAAFIGAGGLGHYIFMGINQSY
DAMVNAGALTVAVMAVVTDYLFGLAEKRMVSKGLRNER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory