SitesBLAST
Comparing WP_075385748.1 NCBI__GCF_002019605.1:WP_075385748.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
C8WR67 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Alicyclobacillus acidocaldarius subsp. acidocaldarius (strain ATCC 27009 / DSM 446 / BCRC 14685 / JCM 5260 / KCTC 1825 / NBRC 15652 / NCIMB 11725 / NRRL B-14509 / 104-IA) (Bacillus acidocaldarius) (see paper)
72% identity, 98% coverage: 1:333/340 of query aligns to 1:333/344 of C8WR67
- YGSQ 25:28 (= YGSQ 25:28) binding
- R48 (= R48) binding ; mutation to P: Inversion of the cofactor specificity from NADPH to NADH.
- S52 (= S52) binding ; mutation to D: Inversion of the cofactor specificity from NADPH to NADH.
- DERQ 82:85 (≠ DENQ 82:85) binding
- G133 (= G133) binding
- D190 (= D190) binding
- E194 (= E194) binding
- E226 (= E226) binding
4tskA Ketol-acid reductoisomerase from alicyclobacillus acidocaldarius (see paper)
72% identity, 97% coverage: 3:333/340 of query aligns to 2:332/333 of 4tskA
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding magnesium ion: D189 (= D190), D189 (= D190), E193 (= E194), E193 (= E194), R246 (= R247), Y247 (= Y248), I249 (= I250), D251 (= D252), Q254 (= Q255)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), L46 (= L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132)
8ep7C Crystal structure of the ketol-acid reductoisomerase from bacillus anthracis in complex with NADP
68% identity, 96% coverage: 5:329/340 of query aligns to 4:328/328 of 8ep7C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), Q83 (≠ N84), V87 (= V88), H106 (= H107)
6bulB Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
65% identity, 96% coverage: 4:328/340 of query aligns to 3:327/327 of 6bulB
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding {hydroxy[(1S)-1-phenylethyl]amino}(oxo)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), E229 (= E230), I233 (= I234), I249 (= I250), S250 (= S251), A253 (= A254)
- binding oxo{[(1S)-1-phenylethyl]amino}acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), E229 (= E230), I233 (= I234), I249 (= I250), S250 (= S251), A253 (= A254)
- binding magnesium ion: D189 (= D190), E193 (= E194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132), S248 (= S249), I249 (= I250), S250 (= S251)
6vo2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg, NADPH and inhibitor. (see paper)
65% identity, 95% coverage: 4:327/340 of query aligns to 3:326/326 of 6vo2A
- binding magnesium ion: D189 (= D190), E193 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132), I249 (= I250), S250 (= S251)
- binding 3-(methylsulfonyl)-2-oxopropanoic acid: G130 (= G131), P131 (= P132), D189 (= D190), E193 (= E194), E229 (= E230), I249 (= I250), S250 (= S251), A253 (= A254)
6c5nA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 1
65% identity, 95% coverage: 4:327/340 of query aligns to 3:326/326 of 6c5nA
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding (cyclopentylamino)(oxo)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), C198 (= C199), E229 (= E230), I233 (= I234), I249 (= I250), S250 (= S251), A253 (= A254)
- binding [cyclopentyl(hydroxy)amino](oxo)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), C198 (= C199), E229 (= E230), I249 (= I250), S250 (= S251), A253 (= A254)
- binding magnesium ion: D189 (= D190), E193 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132), S248 (= S249), I249 (= I250), S250 (= S251)
6c55A Crystal structure of staphylococcus aureus ketol-acid reductosimerrase with hydroxyoxamate inhibitor 3
65% identity, 95% coverage: 4:327/340 of query aligns to 3:326/326 of 6c55A
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding [cyclohexyl(hydroxy)amino](oxo)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), C198 (= C199)
- binding (cyclohexylamino)(oxo)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), C198 (= C199), I249 (= I250), S250 (= S251), A253 (= A254)
- binding magnesium ion: D189 (= D190), E193 (= E194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L79 (= L80), P80 (= P81), D81 (= D82), I83 (≠ N84), H106 (= H107), S248 (= S249), S250 (= S251)
6aqjA Crystal structures of staphylococcus aureus ketol-acid reductoisomerase in complex with two transition state analogs that have biocidal activity. (see paper)
65% identity, 95% coverage: 4:327/340 of query aligns to 3:326/326 of 6aqjA
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding oxo(propan-2-ylamino)acetic acid: P131 (= P132), D189 (= D190), E193 (= E194), E229 (= E230), I233 (= I234), I249 (= I250), S250 (= S251), A253 (= A254)
- binding n-hydroxy-n-isopropyloxamic acid: P131 (= P132), D189 (= D190), E193 (= E194), E229 (= E230), I249 (= I250), S250 (= S251), A253 (= A254)
- binding magnesium ion: D189 (= D190), E193 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132), I249 (= I250), S250 (= S251)
5w3kA Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex NADPH, mg2+ and cpd (see paper)
65% identity, 95% coverage: 4:327/340 of query aligns to 3:326/326 of 5w3kA
- active site: K129 (= K130), D189 (= D190), E193 (= E194)
- binding cyclopropane-1,1-dicarboxylic acid: D189 (= D190), E193 (= E194), E229 (= E230), I249 (= I250), S250 (= S251), A253 (= A254)
- binding magnesium ion: V69 (≠ A70), K70 (≠ A71), A72 (= A73), N100 (≠ K101), D189 (= D190), E193 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), I46 (≠ L47), R47 (= R48), S51 (= S52), L78 (= L79), L79 (= L80), P80 (= P81), D81 (= D82), H106 (= H107), P131 (= P132), G132 (= G133), I249 (= I250), S250 (= S251)
Q02138 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
62% identity, 96% coverage: 3:329/340 of query aligns to 4:330/340 of Q02138
- V48 (≠ L47) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with P-49, L-52 and D-53.
- R49 (= R48) mutation to P: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, L-52 and D-53.
- K52 (= K51) mutation to L: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and D-53.
- S53 (= S52) mutation to D: Inversion of cofactor specificity from NADPH to NADH. Strong decrease of the affinity for NADPH and 2.5-fold increase of the affinity for NADH. 8-fold decrease of the catalytic efficiency for NADPH and 4-fold increase of the catalytic efficiency for NADH; when associated with L-48, P-49 and L-52.
7ke2A Crystal structure of staphylococcus aureus ketol-acid reductoisomerase in complex with mg2+ and nsc116565 (see paper)
63% identity, 94% coverage: 4:324/340 of query aligns to 3:313/313 of 7ke2A
C1DFH7 Ketol-acid reductoisomerase (NADP(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.86 from Azotobacter vinelandii (strain DJ / ATCC BAA-1303) (see paper)
57% identity, 99% coverage: 4:340/340 of query aligns to 3:338/338 of C1DFH7
- D190 (= D190) binding
- E226 (= E226) binding
- E230 (= E230) binding
8upqB Campylobacter jejuni ketol-acid reductoisomerase in complex with 2,3- dihydroxy-3-isovalerate.
57% identity, 99% coverage: 4:340/340 of query aligns to 4:339/342 of 8upqB
4xiyA Crystal structure of ketol-acid reductoisomerase from azotobacter (see paper)
58% identity, 95% coverage: 4:327/340 of query aligns to 3:327/328 of 4xiyA
8uppA Campylobacter jejuni ketol-acid reductoisomerase in complex with NADPH and hoe704
58% identity, 95% coverage: 4:327/340 of query aligns to 3:327/327 of 8uppA
- binding magnesium ion: D190 (= D190), E194 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: F24 (≠ Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), R47 (= R48), S50 (≠ K51), L79 (= L79), P81 (= P81), D82 (= D82), I84 (≠ N84), Q85 (= Q85), I88 (≠ V88), H107 (= H107), P132 (= P132), I250 (= I250), S251 (= S251)
- binding (2R)-(dimethylphosphoryl)(hydroxy)acetic acid: A131 (≠ G131), P132 (= P132), D190 (= D190), E194 (= E194), E230 (= E230), I250 (= I250), S251 (= S251), A254 (= A254)
8sxdA Campylobacter jejuni keto-acid reductoisomerase in complex with intermediate and NADP+
58% identity, 95% coverage: 4:327/340 of query aligns to 3:327/327 of 8sxdA
- binding magnesium ion: D190 (= D190), E194 (= E194)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G24), F24 (≠ Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), S50 (≠ K51), S52 (= S52), L79 (= L79), A80 (≠ L80), P81 (= P81), D82 (= D82), P129 (= P129)
- binding 3-hydroxy-3-methyl-2-oxobutanoic acid: D190 (= D190), E194 (= E194)
7rduA Crystal structure of campylobacter jejuni keto said reductoisomerase in complex with magnesium and oxidixized and reduced NADPH
58% identity, 95% coverage: 4:327/340 of query aligns to 4:328/329 of 7rduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G24 (= G24), G26 (= G26), S27 (= S27), Q28 (= Q28), R48 (= R48), S51 (≠ K51), S53 (= S52), A81 (≠ L80), P82 (= P81), D83 (= D82), I89 (≠ V88), A107 (= A106), H108 (= H107), P130 (= P129), K131 (= K130), A132 (≠ G131)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G24 (= G24), F25 (≠ Y25), G26 (= G26), S27 (= S27), Q28 (= Q28), S51 (≠ K51), S53 (= S52), L80 (= L79), P82 (= P81), D83 (= D82), I89 (≠ V88), A107 (= A106), H108 (= H107)
6l2iA Ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt
62% identity, 94% coverage: 6:325/340 of query aligns to 5:324/324 of 6l2iA
8swmA Crystal structure of campylobacter jejuni ketol-acid reductoisomerase in complex with 2-acetolactate
58% identity, 95% coverage: 5:326/340 of query aligns to 1:323/323 of 8swmA
6l2iB Ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_wt
61% identity, 94% coverage: 6:324/340 of query aligns to 5:323/323 of 6l2iB
- binding magnesium ion: D189 (= D190), D189 (= D190), E193 (= E194), E193 (= E194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y24 (= Y25), G25 (= G26), S26 (= S27), Q27 (= Q28), V46 (≠ L47), R47 (= R48), S51 (= S52), P80 (= P81), D81 (= D82), I83 (≠ N84), L87 (≠ V88), H106 (= H107), P131 (= P132)
Query Sequence
>WP_075385748.1 NCBI__GCF_002019605.1:WP_075385748.1
MANIYYNGDINEGVLQGKTVAIIGYGSQGHAHAQNLRESGTSVVVGLRPGKSFDQAVNDG
FEVLPVREAAAKAEVIMVLLPDENQPKVYKESIEPELTAGKALVFAHGFNIHFNQIQPPA
DVDVFLAAPKGPGHLVRRTYTEGAGVPGLIAVYQDATGQAKELALAYAKQIGSARGGVIE
TTFQEETETDLFGEQAVLCGGTTALVKAGFETLVEAGYQPEVAYFECLHELKLIVDLMYE
GGLEGMRYSISDTAQWGDFVAGPQVVTEDTKKAMKSILSDIQTGKFAKGWILENQANRPE
FNAINESEKKHPIEVVGRELREMMPFVKAKSKGVVGSAKN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory