SitesBLAST
Comparing WP_075859551.1 NCBI__GCF_001950255.1:WP_075859551.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
53% identity, 98% coverage: 4:335/339 of query aligns to 6:346/346 of Q04797
- S98 (= S95) modified: Phosphoserine
- Y146 (≠ G143) modified: Phosphotyrosine
8jusA Crystal structure of aspartate semialdehyde dehydrogenase from porphyromonas gingivalis complexed with 2',5'adenosine diphosphate
53% identity, 97% coverage: 5:333/339 of query aligns to 3:333/335 of 8jusA
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
52% identity, 97% coverage: 3:331/339 of query aligns to 5:334/337 of P23247
- C132 (= C127) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
52% identity, 97% coverage: 3:331/339 of query aligns to 4:333/336 of 2r00C
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N126), C127 (= C127), Q154 (= Q154), G158 (= G158), K222 (= K211), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), N93 (= N93), T94 (≠ S94), P125 (= P125), N126 (= N126), C127 (= C127), G160 (= G160), M161 (≠ I161), G328 (= G317)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N126), C127 (= C127), Q154 (= Q154), G158 (= G158), E219 (= E208), K222 (= K211), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), N93 (= N93), T94 (≠ S94), N126 (= N126), C127 (= C127), G160 (= G160), M161 (≠ I161), G328 (= G317)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R98), G158 (= G158), E219 (= E208), K222 (= K211), R244 (= R233)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), C127 (= C127), S157 (= S157), G158 (= G158), G160 (= G160), M161 (≠ I161), N324 (≠ Q313), L325 (= L314)
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), A71 (= A71), T75 (≠ A75), G160 (= G160), M161 (≠ I161), G162 (≠ E162)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R98), N126 (= N126), C127 (= C127), Q154 (= Q154), G158 (= G158), E219 (= E208), K222 (= K211), R244 (= R233)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), N93 (= N93), T94 (≠ S94), N126 (= N126), C127 (= C127), G160 (= G160), M161 (≠ I161), G328 (= G317)
- binding phthalic acid: S73 (≠ G73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N126), K222 (= K211)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/361 of 3pylC
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G72), S73 (≠ G73), T94 (≠ S94), S95 (= S95), R98 (= R98), K222 (= K211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), N93 (= N93), T94 (≠ S94), N126 (= N126), C127 (= C127), G160 (= G160), G328 (= G317)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (vs. gap), G72 (= G72), S73 (≠ G73), N93 (= N93), T94 (≠ S94), S95 (= S95), R98 (= R98), K222 (= K211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), A71 (= A71), G160 (= G160), M161 (≠ I161), G162 (≠ E162)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 4r3nA
- active site: C127 (= C127), Q154 (= Q154), R244 (= R233), H251 (= H240)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G73), T94 (≠ S94), S95 (= S95), R98 (= R98), N126 (= N126), K222 (= K211)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), N93 (= N93), T94 (≠ S94), N126 (= N126), C127 (= C127), G160 (= G160), M161 (≠ I161), G328 (= G317)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R98), N126 (= N126), G158 (= G158), I208 (= I197), E219 (= E208), K222 (= K211), R244 (= R233)
- binding adenosine-2'-5'-diphosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), A71 (= A71), T75 (≠ A75), G160 (= G160), M161 (≠ I161)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), A71 (= A71), T75 (≠ A75), G160 (= G160)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R98), N126 (= N126), G158 (= G158), A159 (= A159), E219 (= E208), K222 (= K211), R244 (= R233)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 2gz3A
- active site: C127 (= C127), Q154 (= Q154), R244 (= R233), H251 (= H240)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C127), Q154 (= Q154), G158 (= G158), E219 (= E208), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), N93 (= N93), G158 (= G158), G160 (= G160), M161 (≠ I161), N324 (≠ Q313), A329 (= A318)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 2gz2A
- active site: C127 (= C127), Q154 (= Q154), R244 (= R233), H251 (= H240)
- binding adenosine-2'-5'-diphosphate: G8 (= G9), T10 (= T11), G11 (= G12), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), A71 (= A71), T75 (≠ A75)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
49% identity, 99% coverage: 3:336/339 of query aligns to 2:347/357 of 2gz1A
- active site: C127 (= C127), Q154 (= Q154), R244 (= R233), H251 (= H240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), T10 (= T11), G11 (= G12), A12 (= A13), V13 (= V14), A35 (= A36), S36 (≠ T37), R38 (= R39), S39 (= S40), T56 (= T57), S70 (vs. gap), A71 (= A71), G72 (= G72), T75 (≠ A75), N93 (= N93), S157 (= S157), G158 (= G158), G160 (= G160), M161 (≠ I161), N324 (≠ Q313), L325 (= L314)
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
46% identity, 96% coverage: 3:329/339 of query aligns to 2:340/342 of 3tz6A
- active site: C129 (= C127), Q156 (= Q154), R248 (= R233), H255 (= H240)
- binding cysteine: C129 (= C127), Q156 (= Q154), G160 (= G158), E223 (= E208), R248 (= R233), H255 (= H240)
- binding glycerol: S108 (≠ P108), G187 (vs. gap), F192 (vs. gap), P201 (= P188), Q225 (≠ W210), R228 (≠ V213), F229 (= F214), Q335 (= Q324), E338 (= E327), L339 (= L328)
- binding sulfate ion: R98 (= R98), H117 (= H117), R119 (vs. gap), N128 (= N126), C129 (= C127), K226 (= K211), E270 (= E255), R273 (≠ I258)
Query Sequence
>WP_075859551.1 NCBI__GCF_001950255.1:WP_075859551.1
MSYNVVVIGATGAVGGEILKILQERSFPVNKLRLGATARSAGKEVAFRGEIYRVEETTPE
IFEGMDIALFAGGSASKEFARIAAAKGVTVIDNSSAFRLEPDVPLVVPEVNPEDVKHHKG
IIANPNCSTIQMVVALKPLHDYGKIKRVVVSTYQAVSGAGIEAIEELKHQVQAYLNGEEV
EPKVFPYPIAFNLIPHIDVFQDLYYTKEEWKMVFETQKIMHDSEIKVTATTVRVPVFRSH
SESINIETKVKITREKAIELLSNAPGIRVVDNPEEKQYPMPLFASDRDEVYVGRIREDNT
ISNGLNLWVVADQLRKGAATNAVQIAELLIKYGCVKQNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory