SitesBLAST
Comparing WP_075972905.1 NCBI__GCF_001940455.1:WP_075972905.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
62% identity, 99% coverage: 6:453/453 of query aligns to 4:456/459 of P9WIT1
- K354 (≠ E351) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
39% identity, 95% coverage: 18:449/453 of query aligns to 27:460/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ A65), G75 (= G67), S76 (= S68), G77 (= G69), T78 (= T70), G79 (= G71), L80 (= L72), A83 (= A75), C84 (≠ A76), P137 (= P129), G138 (= G130), E139 (= E131), A142 (= A134), T143 (≠ S135), G146 (= G138), N147 (= N139), S149 (≠ A141), T150 (= T142), A152 (= A144), G153 (= G145), E203 (= E195), G204 (= G196), I209 (≠ V201), E422 (= E411), H423 (= H412)
- binding fe (iii) ion: H377 (= H372), H384 (= H379), E422 (= E411)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
33% identity, 91% coverage: 40:450/453 of query aligns to 44:462/465 of 3pm9A
- active site: A149 (= A144), L159 (≠ V154)
- binding flavin-adenine dinucleotide: P69 (≠ A65), Q70 (≠ R66), G71 (= G67), G72 (≠ S68), N73 (≠ G69), T74 (= T70), G75 (= G71), L76 (= L72), G79 (≠ A75), Q80 (≠ A76), L91 (≠ F87), L133 (≠ P129), G134 (= G130), A135 (vs. gap), C139 (≠ A134), T140 (≠ S135), G142 (= G137), G143 (= G138), S146 (≠ A141), T147 (= T142), A149 (= A144), G150 (= G145), E200 (= E195), G201 (= G196), I205 (≠ L200), I206 (≠ V201), E423 (= E411)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W322 (≠ F328), E413 (= E411), H414 (= H412), N450 (= N448)
- binding lactic acid: R318 (= R324), H369 (= H372), H376 (= H379), H414 (= H412)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E411)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (= E28), P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W323 (≠ F328), E414 (= E411), H415 (= H412), N451 (= N448)
- binding manganese (ii) ion: H370 (= H372), H377 (= H379), E414 (= E411)
- binding pyruvic acid: R319 (= R324), H370 (= H372), H377 (= H379), H415 (= H412)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R324), H369 (= H372), H376 (= H379), H414 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W322 (≠ F328), E413 (= E411), H414 (= H412), N450 (= N448)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E411)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R324), W322 (≠ F328), H369 (= H372), H376 (= H379), H414 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W322 (≠ F328), E413 (= E411), N450 (= N448)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E411)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R324), W322 (≠ F328), H369 (= H372), H376 (= H379), H413 (= H412)
- binding flavin-adenine dinucleotide: E32 (= E28), P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W322 (≠ F328), E412 (= E411), H413 (= H412), N449 (= N448)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E412 (= E411)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R324), W322 (≠ F328), S336 (≠ I339), H369 (= H372), H376 (= H379), H413 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), E412 (= E411), N449 (= N448)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E412 (= E411)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L72), R317 (= R324), W321 (≠ F328), H368 (= H372), H375 (= H379), H413 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W321 (≠ F328), Y322 (= Y329), E412 (= E411), H413 (= H412), N449 (= N448)
- binding manganese (ii) ion: H368 (= H372), H375 (= H379), E412 (= E411)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (= E28), P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), W322 (≠ F328), E413 (= E411), H414 (= H412), N450 (= N448)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R324), H369 (= H372), H376 (= H379), H414 (= H412)
- binding manganese (ii) ion: H369 (= H372), H376 (= H379), E413 (= E411)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), H369 (= H372), E413 (= E411), N450 (= N448)
- binding deaminohydroxyvaline: R319 (= R324), H414 (= H412)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), Y324 (= Y329), H370 (= H372), E414 (= E411), N451 (= N448)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R324), W323 (≠ F328), H415 (= H412)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R324), W323 (≠ F328), H370 (= H372), H415 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), H370 (= H372), E414 (= E411), N451 (= N448)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R324), W323 (≠ F328), H415 (= H412)
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), Y324 (= Y329), H370 (= H372), E414 (= E411), N451 (= N448)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), H370 (= H372), E414 (= E411), N451 (= N448)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R324), W323 (≠ F328), H415 (= H412)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), H370 (= H372), E414 (= E411), N451 (= N448)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R324), H415 (= H412)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
34% identity, 95% coverage: 25:453/453 of query aligns to 29:456/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (≠ A65), G70 (= G67), T71 (≠ S68), G72 (= G69), T73 (= T70), G74 (= G71), G78 (≠ A75), V79 (≠ A76), L90 (≠ F87), P132 (= P129), G133 (= G130), A134 (≠ E131), G140 (= G138), M141 (≠ N139), A143 (= A141), T144 (= T142), A146 (= A144), S147 (≠ G145), E200 (= E195), G201 (= G196), I206 (≠ V201), Y324 (= Y329), H370 (= H372), E414 (= E411), N451 (= N448)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L72), R319 (= R324), W323 (≠ F328), H415 (= H412)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
31% identity, 91% coverage: 40:449/453 of query aligns to 50:460/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R324), T337 (≠ F328), K348 (≠ I339), Y379 (≠ C370), H381 (= H372), H388 (= H379), H423 (= H412)
- binding flavin-adenine dinucleotide: P75 (≠ A65), Q76 (≠ R66), G77 (= G67), G78 (≠ S68), N79 (≠ G69), T80 (= T70), G81 (= G71), M82 (≠ L72), G85 (≠ A75), S86 (≠ A76), L139 (≠ P129), G140 (= G130), A141 (vs. gap), C145 (≠ A134), G149 (= G138), N150 (= N139), A152 (= A141), T153 (= T142), G157 (= G146), G207 (= G196), I212 (≠ V201), E422 (= E411), N459 (= N448)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E411)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
31% identity, 91% coverage: 40:449/453 of query aligns to 50:460/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ A65), G77 (= G67), G78 (≠ S68), N79 (≠ G69), T80 (= T70), G81 (= G71), G85 (≠ A75), S86 (≠ A76), L139 (≠ P129), G140 (= G130), A141 (vs. gap), C145 (≠ A134), H146 (≠ S135), G148 (= G137), G149 (= G138), N150 (= N139), A152 (= A141), T153 (= T142), A155 (= A144), E206 (= E195), G207 (= G196), I211 (≠ L200), I212 (≠ V201), E422 (= E411), N459 (= N448)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R324), T337 (≠ F328), K348 (≠ I339), Y379 (≠ C370), H381 (= H372), H388 (= H379), H423 (= H412)
- binding zinc ion: H381 (= H372), H388 (= H379), E422 (= E411)
Sites not aligning to the query:
Query Sequence
>WP_075972905.1 NCBI__GCF_001940455.1:WP_075972905.1
MTDAALAARLTEITGGPTTPGPDDGHDECLTVAGREPAHVVRPETAEQVAAVLKAASEAG
TPVTARGSGTGLSGAAVPSPGGIVVSFERMNAVLEIDTDNHVAVVQPGVTLQELDARTAE
HGLVYPVYPGELSASLGGNIATNAGGMRAVKHGVTRHHVLGLQAALPTGELIRTGGKFAK
ASTGYDLTQLIVGSEGTLALVTEAVLKLQPRVAHQATVLAPFAGLPEVTRAVPRVVGSGL
QPQVLEYIDGMTMAAITHTADLQLGIPDAVRESAQAYLVVVLDGRTQERLDEDVEAVAQL
LSELGAVDAYVLPAGSARKLIEARERAFYTAKAAGADDIIDTVIPRAALPEFMTRVTAIA
QAHQTFVIGCGHAGDGNVHLAVFQKDTATRSTVLHELFAAAMALGGAISGEHGIGHAKRE
HFLALEDPAKVELMRRLKQAFDPAGVLNPGVLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory